Ubiquitin C Antibody - BSA Free

Images

 
Western Blot: Ubiquitin C Antibody [NBP2-94633] - Analysis of extracts of various cell lines, using Ubiquitin C at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more
Immunohistochemistry-Paraffin: Ubiquitin C Antibody [NBP2-94633] - Rat liver using UBC antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Ubiquitin C Antibody [NBP2-94633] - Human esophageal cancer using UBC antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Ubiquitin C Antibody [NBP2-94633] - Mouse brain using UBC antibody at dilution of 1:100 (40x lens).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Ubiquitin C Antibody - BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBC (NP_066289.3). MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:2000
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ubiquitin C Antibody - BSA Free

  • HMG20
  • PolyUbiquitin
  • polyubiquitin-B
  • Polyubiquitin-C
  • UBC
  • Ubiquitin-40S ribosomal protein S27a
  • ubiquitin-60S ribosomal protein L40

Background

Ubiquitin is a small protein that is composed of 76 amino acids and its sequence is highly conserved throughout evolution from invertebrates to mammals. In the cytoplasm, ubiquitin is involved in ATP-dependent nonlysomal proteolysis of various proteins. In the nucleus, ubiquitin is conjugated to histone2A and may play a role in regulation of chromatin structure and/or regulation of transcriptional activity.Ubiquitin(76amino acid) was overexpressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-64792
Species: Hu, Mu, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB100-56360
Species: Hu
Applications: WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6609
Species: Hu, Mu
Applications: IHC, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94633
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Ubiquitin C Antibody (NBP2-94633) (0)

There are no publications for Ubiquitin C Antibody (NBP2-94633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin C Antibody (NBP2-94633) (0)

There are no reviews for Ubiquitin C Antibody (NBP2-94633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ubiquitin C Antibody (NBP2-94633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ubiquitin C Products

Diseases for Ubiquitin C Antibody (NBP2-94633)

Discover more about diseases related to Ubiquitin C Antibody (NBP2-94633).
 

Pathways for Ubiquitin C Antibody (NBP2-94633)

View related products by pathway.

PTMs for Ubiquitin C Antibody (NBP2-94633)

Learn more about PTMs related to Ubiquitin C Antibody (NBP2-94633).
 

Research Areas for Ubiquitin C Antibody (NBP2-94633)

Find related products by research area.

Blogs on Ubiquitin C

There are no specific blogs for Ubiquitin C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ubiquitin C Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UBC