BAMBI/NMA Antibody - BSA Free

Immunohistochemistry-Paraffin: BAMBI/NMA Antibody [NBP1-82551] - Staining of human bronchus shows strong positivity in respiratory epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BAMBI/NMA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BAMBI/NMA Antibody - BSA Free (NBP1-82551) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
• Predicted Species: Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAMBI
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BAMBI/NMA Protein (NBP1-82551PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BAMBI/NMA Antibody - BSA Free

• BAMBI
• BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
• BMP and activin membrane-bound inhibitor homolog
• NMA
• NMANon-metastatic gene A protein
• Putative transmembrane protein NMA

Background

BAMBI encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for BAMBI/NMA Antibody (NBP1-82551). (Showing 1 - 2 of 2 FAQ).

1. I'm working on BAMBI since last 3 years and have a great evidence of BAMBI action in endothelial cells, please refer to our recent papers on Pubmed http://www.ncbi.nlm.nih.gov/pubmed?term=kollins%20d . Our trouble is to stain BAMBI on paraffin fixed human tissues. The image, you have in the product description surprises me, as I don't know about BAMBI presence in epithelial cells, but the protein size in western is correct. Would it be possible that you provide us a small test sample of your antibody? As a co-author of this paper I'm quite aware of Bambi expression in endothelial cells (what is the paper about), but we didn't use your antibody in our experiments. Do you have any references which describe trials with your antibody? If not, I'm suggesting again to try it (free sample) in our proved setting. In case it works, you will get a nice reference and we a working antibody in paraffin preserved tissue.
   • I can assure you this image is reliable and that the protein is present in epithelial cells. Please see this link (http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0012995). Did you carry out antigen retrieval? I recommend the citrate buffer method. The epitope may be masked. Unfortunately we do not have any references describing our antibodies and we do not provide free samples.
2. I was wondering if BAMBI antibody (NBP1-82551) has been tested in mouse tissue for immunohistochemistry. Do you have other BAMBI antibody for IHC in mouse tissue?
   • We currently only sell three BAMBI antibodies in total, none of which have yet been tested in mouse, and only one of which has IHC as a validated application - NBP1-82551, the one you mentioned. Because NBP1-82551 has not yet been tested with mouse samples, we cannot guarantee that it would be suitable. However, the exact immunogen sequence of this antibody is shown on its web page / datasheet, and I have carried out a UniProt Blast sequence analysis of Q9D0L6 to get an indication of the likely cross-reactivity. The result was a 94% match with mouse BAMBI. This is a high degree of sequence similarity, which means that the antibody is likely to detect the mouse protein. If you did test NBP1-82551 with mouse tissue, you would be eligible for our special Innovators Reward Program, where in return for sharing your findings with us (whether the antibody proved suitable or not) by completing a review, we would give you a voucher code for the price of the product, for you to use on a future purchase.

Bioinformatics

• Gene Symbol: BAMBI