BAMBI/NMA Antibody

Images

 
Western Blot: BAMBI/NMA Antibody [NBP1-82551] - Analysis in control (vector only transfected HEK293T lysate) and BAMBI over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: BAMBI/NMA Antibody [NBP1-82551] - Staining of human bronchus shows strong positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAMBI/NMA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAMBI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAMBI/NMA Protein (NBP1-82551PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAMBI/NMA Antibody

  • BAMBI
  • BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
  • BMP and activin membrane-bound inhibitor homolog
  • NMA
  • NMANon-metastatic gene A protein
  • Putative transmembrane protein NMA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-26612
Species: Hu
Applications: IP (-), WB

Publications for BAMBI/NMA Antibody (NBP1-82551) (0)

There are no publications for BAMBI/NMA Antibody (NBP1-82551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAMBI/NMA Antibody (NBP1-82551) (0)

There are no reviews for BAMBI/NMA Antibody (NBP1-82551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAMBI/NMA Antibody (NBP1-82551). (Showing 1 - 2 of 2 FAQ).

  1. I'm working on BAMBI since last 3 years and have a great evidence of BAMBI action in endothelial cells, please refer to our recent papers on Pubmed http://www.ncbi.nlm.nih.gov/pubmed?term=kollins%20d. Our trouble is to stain BAMBI on paraffin fixed human tissues. The image, you have in the product description surprises me, as I don't know about BAMBI presence in epithelial cells, but the protein size in western is correct. Would it be possible that you provide us a small test sample of your antibody? As a co-author of this paper I'm quite aware of Bambi expression in endothelial cells (what is the paper about), but we didn't use your antibody in our experiments. Do you have any references which describe trials with your antibody? If not, I'm suggesting again to try it (free sample) in our proved setting. In case it works, you will get a nice reference and we a working antibody in paraffin preserved tissue.
    • I can assure you this image is reliable and that the protein is present in epithelial cells. Please see this link: Research Article. Did you carry out antigen retrieval? I recommend the citrate buffer method. The epitope may be masked. Unfortunately we do not have any references describing our antibodies and we do not provide free samples.
  2. I was wondering if BAMBI antibody (NBP1-82551) has been tested in mouse tissue for immunohistochemistry. Do you have other BAMBI antibody for IHC in mouse tissue?
    • We currently only sell three BAMBI antibodies in total, none of which have yet been tested in mouse, and only one of which has IHC as a validated application - NBP1-82551, the one you mentioned. Because NBP1-82551 has not yet been tested with mouse samples, we cannot guarantee that it would be suitable. However, the exact immunogen sequence of this antibody is shown on its web page / datasheet, and I have carried out a UniProt Blast sequence analysis of Q9D0L6 to get an indication of the likely cross-reactivity. The result was a 94% match with mouse BAMBI. This is a high degree of sequence similarity, which means that the antibody is likely to detect the mouse protein. If you did test NBP1-82551 with mouse tissue, you would be eligible for our special Innovators Reward Program, where in return for sharing your findings with us (whether the antibody proved suitable or not) by completing a review, we would give you a voucher code for the price of the product, for you to use on a future purchase.

Secondary Antibodies

 

Isotype Controls

Additional BAMBI/NMA Products

Bioinformatics Tool for BAMBI/NMA Antibody (NBP1-82551)

Discover related pathways, diseases and genes to BAMBI/NMA Antibody (NBP1-82551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAMBI/NMA Antibody (NBP1-82551)

Discover more about diseases related to BAMBI/NMA Antibody (NBP1-82551).
 

Pathways for BAMBI/NMA Antibody (NBP1-82551)

View related products by pathway.

PTMs for BAMBI/NMA Antibody (NBP1-82551)

Learn more about PTMs related to BAMBI/NMA Antibody (NBP1-82551).

Blogs on BAMBI/NMA

There are no specific blogs for BAMBI/NMA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAMBI/NMA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAMBI
Entrez