AMPK beta 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining in human kidney and skeletal muscle tissues.. Corresponding PRKAB1 RNA-seq data are presented for the same tissues.

Western Blot: AMPK beta 1 Antibody [NBP1-87487] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody [NBP1-87487] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.

Western Blot: AMPK beta 1 Antibody [NBP1-87487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: AMPK beta 1 Antibody [NBP1-87487] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMPK beta 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AMPK beta 1 Protein (NBP1-87487PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMPK beta 1 Antibody - BSA Free

• 5'-AMP-activated protein kinase beta-1 subunit
• AMP-activated protein kinase beta subunit
• AMPK beta -1 chain
• AMPK beta 1
• AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1
• AMPK subunit beta-1
• AMPK
• AMPKb
• HAMPKb
• MGC17785
• PRKAB1
• protein kinase, AMP-activated, beta 1 non-catalytic subunit
• protein kinase, AMP-activated, noncatalytic, beta-1

Background

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AMPK beta 1 Antibody (NBP1-87487)(2)

Publications using NBP1-87487

• Ding S, Pandey A, Feng X et al. Interactions between fungal hyaluronic acid and host CD44 promotes internalization by recruiting host autophagy proteins to forming phagosomes iScience 2021-03-15 [PMID: 33718841]
• A Pandey, SL Ding, QM Qin, R Gupta, G Gomez, F Lin, X Feng, L Fachini da, SP Chaki, M Katepalli, ED Case, EJ van Schaik, T Sidiq, O Khalaf, A Arenas, KS Kobayashi, JE Samuel, GM Rivera, RC Alaniz, SH Sze, X Qian, WJ Brown, A Rice-Ficht, WK Russell, TA Ficht, P de Figueir Global Reprogramming of Host Kinase Signaling in Response to Fungal Infection Cell Host Microbe, 2017-05-10;21(5):637-649.e6. 2017-05-10 [PMID: 28494245]

Bioinformatics

• Gene Symbol: PRKAB1