PYK2/FAK2 Antibody

Images

 
Orthogonal Strategies: Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis in human cell lines A-431 and HEK293 using anti-PTK2B antibody. Corresponding PTK2B RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody [NBP1-91228] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PYK2/FAK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM
Specificity
Specificity of human, rat PYK2/FAK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTK2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
PYK2/FAK2 Lysate (NBP2-66284)
Control Peptide
PYK2/FAK2 Protein (NBP1-91228PEP)
Publications
Read Publication using
NBP1-91228 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PYK2/FAK2 Antibody

  • CADTK
  • CADTKCAK-beta
  • CAK beta
  • CAKB
  • Calcium-dependent tyrosine kinase
  • Cell adhesion kinase beta
  • EC 2.7.10
  • FADK2
  • FAK2
  • FAK2EC 2.7.10.2
  • Focal adhesion kinase 2
  • FRNK
  • PKB
  • Proline-rich tyrosine kinase 2
  • protein kinase B
  • protein tyrosine kinase 2 beta
  • protein-tyrosine kinase 2-beta
  • PTK
  • PTK2B protein tyrosine kinase 2 beta
  • PTK2B
  • PYK2
  • PYK2Related adhesion focal tyrosine kinase
  • RAFTK
  • RAFTKFADK 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-607
Species: Hu, Rt
Applications: WB, EM, ELISA, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PYK2/FAK2 Antibody (NBP1-91228)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PYK2/FAK2 Antibody (NBP1-91228) (0)

There are no reviews for PYK2/FAK2 Antibody (NBP1-91228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PYK2/FAK2 Antibody (NBP1-91228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional PYK2/FAK2 Products

Bioinformatics Tool for PYK2/FAK2 Antibody (NBP1-91228)

Discover related pathways, diseases and genes to PYK2/FAK2 Antibody (NBP1-91228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYK2/FAK2 Antibody (NBP1-91228)

Discover more about diseases related to PYK2/FAK2 Antibody (NBP1-91228).
 

Pathways for PYK2/FAK2 Antibody (NBP1-91228)

View related products by pathway.

PTMs for PYK2/FAK2 Antibody (NBP1-91228)

Learn more about PTMs related to PYK2/FAK2 Antibody (NBP1-91228).
 

Research Areas for PYK2/FAK2 Antibody (NBP1-91228)

Find related products by research area.

Blogs on PYK2/FAK2

There are no specific blogs for PYK2/FAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYK2/FAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTK2B
Entrez