PYK2/FAK2 Antibody

Images

 
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis using Anti-PTK2B antibody NBP1-91228 (A) shows similar pattern to independent antibody NBP1-91227 (B).
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody [NBP1-91228] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Orthogonal Strategies: Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis in human cell lines A-431 and HEK293 using anti-PTK2B antibody. Corresponding PTK2B RNA-seq data are presented for the same cell ...read more
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Human breast cancer cell line MDA-MB-231 was treated with carboplatin for 72 hours and the expression of phospho-PYK2 and total PYK2 were detected by Western blot. Image ...read more
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PYK2/FAK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM
Specificity
Specificity of human, rat PYK2/FAK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTK2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PYK2/FAK2 Lysate (NBP2-66284)
Control Peptide
PYK2/FAK2 Protein (NBP1-91228PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-91228 in the following applications:

Publications
Read Publication using
NBP1-91228 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PYK2/FAK2 Antibody

  • CADTK
  • CADTKCAK-beta
  • CAK beta
  • CAKB
  • Calcium-dependent tyrosine kinase
  • Cell adhesion kinase beta
  • EC 2.7.10
  • FADK2
  • FAK2
  • FAK2EC 2.7.10.2
  • Focal adhesion kinase 2
  • FRNK
  • PKB
  • Proline-rich tyrosine kinase 2
  • protein kinase B
  • protein tyrosine kinase 2 beta
  • protein-tyrosine kinase 2-beta
  • PTK
  • PTK2B protein tyrosine kinase 2 beta
  • PTK2B
  • PYK2
  • PYK2Related adhesion focal tyrosine kinase
  • RAFTK
  • RAFTKFADK 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-240
Species: Hu
Applications: WB, IHC, IP, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-45435
Species: Hu
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PYK2/FAK2 Antibody (NBP1-91228)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for PYK2/FAK2 Antibody (NBP1-91228) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91228:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PYK2/FAK2 NBP1-91228
Enlarge
reviewed by:
Anonymous
WB Human 09/21/2018
View

Summary

ApplicationWestern Blot
Sample TestedBreast cancer cells
SpeciesHuman
LotR12514

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PYK2/FAK2 Antibody (NBP1-91228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PYK2/FAK2 Antibody (NBP1-91228)

Discover related pathways, diseases and genes to PYK2/FAK2 Antibody (NBP1-91228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYK2/FAK2 Antibody (NBP1-91228)

Discover more about diseases related to PYK2/FAK2 Antibody (NBP1-91228).
 

Pathways for PYK2/FAK2 Antibody (NBP1-91228)

View related products by pathway.

PTMs for PYK2/FAK2 Antibody (NBP1-91228)

Learn more about PTMs related to PYK2/FAK2 Antibody (NBP1-91228).
 

Research Areas for PYK2/FAK2 Antibody (NBP1-91228)

Find related products by research area.

Blogs on PYK2/FAK2

There are no specific blogs for PYK2/FAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/21/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol PTK2B