AMPK beta 1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit AMPK beta 1 Antibody - BSA Free (NBP1-87487) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-AMPK beta 1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRKAB1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for AMPK beta 1 Antibody - BSA Free
Background
The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1). AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits (2). The alpha subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (3). AMPK beta-1 mediates the association of the AMPK heterotrimeric complex in vitro (2). Two isoforms have been found and the difference in expression patterns indicates tissue-specific roles for these isoforms (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for AMPK beta 1 Antibody (NBP1-87487)(2)
Showing Publications 1 -
2 of 2.
| Publications using NBP1-87487 |
Applications |
Species |
| Ding S, Pandey A, Feng X et al. Interactions between fungal hyaluronic acid and host CD44 promotes internalization by recruiting host autophagy proteins to forming phagosomes iScience 2021-03-15 [PMID: 33718841] |
|
|
| A Pandey, SL Ding, QM Qin, R Gupta, G Gomez, F Lin, X Feng, L Fachini da, SP Chaki, M Katepalli, ED Case, EJ van Schaik, T Sidiq, O Khalaf, A Arenas, KS Kobayashi, JE Samuel, GM Rivera, RC Alaniz, SH Sze, X Qian, WJ Brown, A Rice-Ficht, WK Russell, TA Ficht, P de Figueir Global Reprogramming of Host Kinase Signaling in Response to Fungal Infection Cell Host Microbe, 2017-05-10;21(5):637-649.e6. 2017-05-10 [PMID: 28494245] |
|
|
Reviews for AMPK beta 1 Antibody (NBP1-87487) (0)
There are no reviews for AMPK beta 1 Antibody (NBP1-87487).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AMPK beta 1 Antibody (NBP1-87487) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AMPK beta 1 Products
Research Areas for AMPK beta 1 Antibody (NBP1-87487)
Find related products by research area.
|
Blogs on AMPK beta 1