ATIC Antibody

Images

 
Genetic Strategies: Western Blot: ATIC Antibody [NBP1-89192] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATIC antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ATIC Antibody [NBP1-89192] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATIC Antibody [NBP1-89192] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: ATIC Antibody [NBP1-89192] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ATIC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATIC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATIC Protein (NBP1-89192PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATIC Antibody

  • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMPcyclohydrolase
  • 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotidetransformylase/inosinicase
  • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
  • AICAR
  • AICARFT
  • AICARFT/IMPCHASE
  • bifunctional purine biosynthesis protein PURH
  • IMPCHASE
  • phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  • PURHFLJ93545

Background

ATIC is a 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase which helps catalyze the penultimate and final steps of the de novo purine biosynthetic pathway. The human ATIC cDNA encodes a deduced 591 amino acid protein that is 81% identical to the chicken sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATIC Antibody (NBP1-89192) (0)

There are no publications for ATIC Antibody (NBP1-89192).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATIC Antibody (NBP1-89192) (0)

There are no reviews for ATIC Antibody (NBP1-89192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATIC Antibody (NBP1-89192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATIC Products

Research Areas for ATIC Antibody (NBP1-89192)

Find related products by research area.

Blogs on ATIC

There are no specific blogs for ATIC, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATIC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATIC