alpha Tubulin 4a Antibody - BSA Free

Images

 
Western Blot: alpha Tubulin 4a Antibody [NBP3-38636] - Western blot analysis of various lysates using alpha Tubulin 4a Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at ...read more
Western Blot: alpha Tubulin 4a Antibody [NBP3-38636] - Western blot analysis of various lysates, using alpha Tubulin 4a Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at ...read more
Immunocytochemistry/ Immunofluorescence: alpha Tubulin 4a Antibody [NBP3-38636] - Confocal immunofluorescence analysis of U2OS cells using alpha Tubulin 4a Rabbit pAb at dilution of 1:100 (60x lens). Blue: DAPI for ...read more
Immunocytochemistry/ Immunofluorescence: alpha Tubulin 4a Antibody [NBP3-38636] - Immunofluorescence analysis of U2OS cells using alpha Tubulin 4a Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

alpha Tubulin 4a Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human alpha Tubulin 4a (NP_005991.1).

Sequence:
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBA4A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for alpha Tubulin 4a Antibody - BSA Free

  • alpha 1 (testis specific)
  • alpha Tubulin 4a
  • Alpha-tubulin 1
  • FLJ30169
  • H2-ALPHA
  • Testis-specific alpha-tubulin
  • TUBA1
  • TUBA4A
  • Tubulin alpha-1 chain
  • tubulin alpha-4A chain
  • Tubulin H2-alpha
  • tubulin, alpha 1
  • tubulin, alpha 4a

Background

Microtubules are involved in a wide variety of cellular activities ranging from mitosis and transport events to cell movement and the maintainance of cell shape. Tubulin itself is a globular protein which consists of two polypeptides (alpha and beta tubulin). Alpha and beta tubulin dimers are assembled to 13 protofilaments that form a microtubule of 22 nm diameter. Tyrosine ligase ads a C-terminal tyrosin to monomeric alpha tubulin. Assembled microtubules can again be detyrosinated by a cytoskeleton associated carboxypeptidase. Detyrosinated alpha tubulin is referred to as Glu-tubulin. Another post-translational modification of detyrosinated alpha tubulin is C-terminal polyglutamylation which is characteristic for microtubules in neuronal cells and the mitotic spindle. Alpha tubulin is not suitable as loading control in adipose tissue as expression of tubulin in adipose tissue is very low ( Spiegelman and Farmer, Cell, 1982, 29(1):53-60) in cells undergoing adipose differentiation actin synthesis decreases by 90%. Excellent as a protein loading control antibody.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, RIA, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-64792
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
U-100H
Species: Hu
Applications: EnzAct
NBP3-25485
Species: Ca, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-690
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, Simple Western, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-46814
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38636
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for alpha Tubulin 4a Antibody (NBP3-38636) (0)

There are no publications for alpha Tubulin 4a Antibody (NBP3-38636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Tubulin 4a Antibody (NBP3-38636) (0)

There are no reviews for alpha Tubulin 4a Antibody (NBP3-38636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha Tubulin 4a Antibody (NBP3-38636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha Tubulin 4a Products

Research Areas for alpha Tubulin 4a Antibody (NBP3-38636)

Find related products by research area.

Blogs on alpha Tubulin 4a.

Tubulin alpha 4A - A ubiquitous tubulin isoform linked to ALS and infertility
Microtubules are a main component of the cytoskeleton and play essential roles in a variety of cellular processes. These highly dynamic tubular structures are assembled from alpha- and beta-tubulin dimers to form a complex structural network of mic...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha Tubulin 4a Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBA4A