RUNX1/CBFA2 Antibody

Images

 
Western Blot: RUNX1/CBFA2 Antibody [NBP1-89105] - Analysis in control (vector only transfected HEK293T lysate) and rUNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUNX1/CBFA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
Localization
Nucleus
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RUNX1/CBFA2 Protein (NBP1-89105PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89105 in the following applications:

Publications
Read Publication using
NBP1-89105 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24967588).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNX1/CBFA2 Antibody

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
AF5414
Species: Hu
Applications: WB, Simple Western
NB600-248
Species: Hu
Applications: WB, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
MAB17791
Species: Hu, Mu
Applications: WB
AF7349
Species: Hu, Mu
Applications: WB, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RUNX1/CBFA2 Antibody (NBP1-89105)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RUNX1/CBFA2 Antibody (NBP1-89105) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89105:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge
reviewed by:
Anonymous
WB Human 06/17/2013
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 whole cell lysate
SpeciesHuman
LotB81262
CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Blocking

Blocking Detailsblocked in 10% powdered milk, 1 hour at room temp.

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP linked
Secondary Manufacturer Cat#Cell signaling 7074
Secondary Concentration1:2500

Comments

CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (NBP1-89105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1/CBFA2 Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (NBP1-89105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover more about diseases related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Pathways for RUNX1/CBFA2 Antibody (NBP1-89105)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (NBP1-89105)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Research Areas for RUNX1/CBFA2 Antibody (NBP1-89105)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
06/17/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol RUNX1
Entrez