Home » RUNX1/CBFA2 » RUNX1/CBFA2 Antibodies » RUNX1/CBFA2 Antibody

RUNX1/CBFA2 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RUNX1/CBFA2 Antibody [NBP1-89105] - Analysis in control (vector only transfected HEK293T lysate) and rUNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: RUNX1/CBFA2 Antibody [NBP1-89105] - Analysis in control (vector only transfected HEK293T lysate) and rUNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human bone marrow and skeletal muscle tissues using anti-RUNX1 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RUNX1/CBFA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
Localization
Nucleus
Specificity
Specificity of human RUNX1/CBFA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RUNX1/CBFA2 Protein (NBP1-89105PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89105 in the following applications:
Publications
Read Publication using
NBP1-89105 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24967588).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNX1/CBFA2 Antibody

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1T1/ETO
Antibody
NBP2-55747
Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
(1 Review)
Species: Hu
Applications: WB, ICC/IF
ETV6/Tel Antibody
NBP1-80695
Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell line HDLM-2.
Immunocytochemistry/Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining in human breast and kidney tissues using anti-ETV6 antibody. Corresponding ETV6 RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EVI-1 Antibody
NBP2-48848
Western Blot: EVI-1 Antibody [NBP2-48848] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: EVI-1 Antibody [NBP2-48848] - Staining of human cell line HEK 293 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RUNX2/CBFA1
Antibody
NBP1-77461
Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Immunohistochemistry: RUNX2/CBFA1 Antibody [NBP1-77461] - Staining of RUNX2 in mouse prostate using DAB with hematoxylin counterstain.
(6 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
RUNX3/CBFA3
Antibody (527327) [Un ...
MAB3765
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Daudi human Burkitt's lymphoma cell line, and DA3 mouse myeloma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc). PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for RUNX3/CBFA3 at approximately 48 and 52  kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
RUNX3/CBFA3 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.5 mg/mL. A specific band was detected for RUNX3/CBFA3 at approximately 54 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western
KMT2A/MLL Antibody
NB600-248
Western Blot: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear extract (50 and 15 ug) from HeLa, 293T, and Jurkat cells. Antibody: Affinity purified rabbit anti-MLL1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: KMT2A/MLL Antibody [NB600-248] - Samples: Nuclear Extract (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MLL1 antibody NB600-248 used for IP at 6 ug per reaction. MLL1 was also immunoprecipitated by rabbit anti-MLL1 antibody NB600-249. For blotting immunoprecipitated MLL1, NB600-248 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(1 Review)
(25 Publications)
Species: Hu
Applications: WB, IP
CBF2 Antibody
H00010153-B01P
Western Blot: CBF2 Antibody [H00010153-B01P] - Analysis of CEBPZ expression in K-562.
Immunocytochemistry/Immunofluorescence: CBF2 Antibody [H00010153-B01P] - Analysis of purified antibody to CEBPZ on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: CBF2 Antibody [H00010153-B01P] - Analysis of CEBPZ expression in PC-12.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Flt-3/Flk-2/CD135
Antibody (7E8.2C8)
NBP2-42210
Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.
Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.
Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis
Species: Hu
Applications: WB, Flow, IHC, IHC-P
ASXL1 Antibody
(6E2)
H00171023-M05
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA
CCR7 Antibody
(150503) [Unconjugate
MAB197
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human CD4 PE‑conjugated Monoclonal Antibody (Catalog # FAB3791P) and either (A) Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197) or (B) Mouse IgG2A Isotype Control (Catalog # MAB003) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CCR7 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using 25 µg/mL Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Recombinant Human CCL19/MIP‑3 beta (Catalog # 361‑MI) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR7 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL19/MIP‑3 beta (50 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197). The ND50 is typically 1-5 µg/mL.
(2 Reviews)
(73 Publications)
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
SCL/Tal1 Antibody
NBP1-33757
Western Blot: SCL/Tal1 Antibody [NBP1-33757] - Sample (30 ug of whole cell lysate) A: H1299 10% SDS PAGE; antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: SCL/Tal1 Antibody [NBP1-33757] - Paraffin-embedded mouse spleen dilution: 1:500.
Immunohistochemistry-Paraffin: SCL/Tal1 Antibody [NBP1-33757] - Paraffin-embedded A549 Xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
SAP155 Antibody
NBP2-47291
Western Blot: SAP155 Antibody [NBP2-47291] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: SAP155 Antibody [NBP2-47291] - Immunofluorescent staining of human cell line HeLa shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SAP155 Antibody [NBP2-47291] - Immunohistochemical staining of human salivary gland shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GATA-1 Antibody
(4F5)
NBP1-47492
Western Blot: GATA-1 Antibody (4F5) [NBP1-47492] - Western blot analysis using GATA1 mouse mAb against K562 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Immunofluorescence analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Immunohistochemical analysis of paraffin-embedded pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CBFB Antibody
AF7349
Western blot shows lysates of M1 mouse myeloid leukemia cell line and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CBFB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7349) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CBFB at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CBFB was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Sheep Anti-Human/Mouse CBFB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7349) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu
Applications: WB, ICC
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
LIS1 Antibody
NBP1-87769
Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
(2 Reviews)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RUNX1/CBFA2
Antibody
NBP1-89105
RUNX1/CBFA2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RUNX1/CBFA2 Antibody (NBP1-89105)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RUNX1/CBFA2 Antibody (NBP1-89105) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89105:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge
reviewed by:
Anonymous
 WB Human 06/17/2013
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 whole cell lysate
SpeciesHuman
LotB81262
CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Blocking

Blocking Detailsblocked in 10% powdered milk, 1 hour at room temp.

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP linked
Secondary Manufacturer Cat#Cell signaling 7074
Secondary Concentration1:2500

Comments

CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (NBP1-89105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (NBP1-89105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover more about diseases related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Pathways for RUNX1/CBFA2 Antibody (NBP1-89105)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (NBP1-89105)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Research Areas for RUNX1/CBFA2 Antibody (NBP1-89105)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge
 Anonymous
06/17/2013
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol RUNX1
Entrez