RUNX1/CBFA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human lymphoid tissues shows moderate to strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RUNX1/CBFA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
• Localization: Nucleus
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in (PMID: 24967588).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  RUNX1/CBFA2 Recombinant Protein Antigen (NBP1-89105PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RUNX1/CBFA2 Antibody - BSA Free

• Acute myeloid leukemia 1 protein
• AML1
• AML1acute myeloid leukemia 1
• AML1-EVI-1
• CBFA2
• CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
• Core-binding factor subunit alpha-2
• EVI-1
• PEBP2A2
• runt domain, alpha subunit 2
• runt-related transcription factor 1
• RUNX1
• SL3/AKV core-binding factor alpha B subunit

Background

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RUNX1/CBFA2 Antibody (NBP1-89105)(3)

Publications using NBP1-89105

• Day RB, Hickman JA, Xu Z et Al. Proteogenomic analysis reveals cytoplasmic sequestration of RUNX1 by the acute myeloid leukemia-initiating CBFB::MYH11 oncofusion protein J Clin Invest 2023-12-07 [PMID: 38061017]
• Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature 2022-05-25 [PMID: 35614216] (IHC-Fr, Mouse)
• Ferrari N, Mohammed ZM, Nixon C et al. Expression of RUNX1 Correlates with Poor Patient Prognosis in Triple Negative Breast Cancer. PLoS One 2014-01-01 [PMID: 24967588] (WB, IF/IHC, Human)

Review for RUNX1/CBFA2 Antibody (NBP1-89105) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 06/17/2013

Summary

• Application: Western Blot
• Sample Tested: HEK 293 whole cell lysate
• Species: Human
• Lot: B81262

Bioinformatics

• Gene Symbol: RUNX1
• Entrez:
  • 861(Human)