Home » RUNX1/CBFA2 » RUNX1/CBFA2 Antibodies » RUNX1/CBFA2 Antibody

RUNX1/CBFA2 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human lymphoid tissues shows moderate to strong nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

RUNX1/CBFA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
Localization
Nucleus
Specificity
Specificity of human RUNX1/CBFA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100. WB and IHC reacitivity reported in (PMID: 24967588).
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RUNX1/CBFA2 Protein (NBP1-89105PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89105 in the following applications:
Publications
Read Publication using
NBP1-89105 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24967588).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNX1/CBFA2 Antibody

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1T1/ETO
Antibody
NBP2-55747
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF
ETV6/Tel Antibody
NBP1-80695
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining in human breast and kidney tissues using anti-ETV6 antibody. Corresponding ETV6 RNA-seq data are presented for the same tissues.
Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ETV6/Tel Antibody [NBP1-80695] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EVI-1 Antibody
NBP2-48848
Western Blot: EVI-1 Antibody [NBP2-48848] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: EVI-1 Antibody [NBP2-48848] - Staining of human cell line HEK 293 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RUNX2/CBFA1
Antibody
NBP1-77461
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Vascularization of mineralized cell-laden collagen and interaction with prostate cancer cells. HUVECs formed endothelial networks that were supported by SMA-expressing hMSCs (scale bar: 50m) and were also positive for CD31 (scale bar: 400m). The remainder of hMSCs expressed RUNX2 as a marker for osteogenic differentiation (scale bar: 50m). Rapid fabrication of vascularized and innervated cell-laden bone models with biomimetic intrafibrillar collagen mineralization. Nat Commun (2019)
Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Characterization of TLC cultured in chondrogenic pellets. Gene expression of TLC cultured four weeks in chondrogenic pellets or in cell monolayer in control medium: levels of expression of osteoblast markers (1), chondrocyte markers (2) and tenocyte markers (3) (N = 3) assessed by qPCR.* =0.05. Rotator Cuff Tenocytes Differentiate into Hypertrophic Chondrocyte-Like Cells to Produce Calcium Deposits in an Alkaline Phosphatase-Dependent Manner. J Clin Med (2019)
(11 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
RUNX3/CBFA3
Antibody (527327) [Un ...
MAB3765
RUNX3/CBFA3 Antibody (527327) [Unconjugated]
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
c-Abl Antibody
(8E9)
NBP2-49695
Western Blot: c-Abl Antibody (8E9) [NBP2-49695] - Analysis of c-Abl using c-Abl Monoclonal Antibody on HeLa Cells.
Immunocytochemistry/Immunofluorescence: c-Abl Antibody (8E9) [NBP2-49695] - taining in the cytoplasm of NIH-3T3 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a c-Abl monoclonal antibody in 3% BSA-PBS at a dilution of 1:50 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
Immunohistochemistry-Paraffin: c-Abl Antibody (8E9) [NBP2-49695] - Analysis of human placenta stained with cbl antibody using peroxidase-conjugate and AEC chromogen. Note cytoplasmic staining of trophoblasts.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CBF2 Antibody
NBP2-47525
Western Blot: CBF2 Antibody [NBP2-47525] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2
Immunohistochemistry: CBF2 Antibody [NBP2-47525] - Analysis of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
(2 Reviews)
Species: Hu
Applications: WB, IHC, IHC-P
BCR Antibody
NBP1-19098
Western Blot: BCR Antibody [NBP1-19098] - Whole cell lysate from HeLa and 293T cells. BCR was also immunoprecipitated by rabbit anti-BCR antibody NBP1-19097.
Immunocytochemistry/Immunofluorescence: BCR Antibody [NBP1-19098] - Human K562 cells (contains the chromosomal translocation, t(9:22) that creates the BCR/ABL fusion gene). Antibody used at a dilution of 1:1,000 (1ug/ml). Detection: Green-fluorescent goat anti-rabbit IgG - Alexa Fluor 488 used at a dilution of 1:1,000.
Flow Cytometry: BCR Antibody [NBP1-19098] - Flow Cytometric Detection of BCR. 1 x 106 K562 cells were fixed, permeabilized, and stained with 0.25 mcg anti-BCR in a 150 mcl reaction. Isotype anti-KLH control (red), no antibody (blue) and anti-BCR (black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Flt-3/Flk-2/CD135
Antibody (7E8.2C8)
NBP2-42210
Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position.
Immunohistochemistry-Paraffin: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells while the tumor stroma was largely negative for the staining.
Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) [NBP2-42210] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis
Species: Hu
Applications: WB, Flow, IHC, IHC-P
ASXL1 Antibody
(6E2)
H00171023-M05
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction. Evaluation of ASXL1 protein expression by Western blotting. Left-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), and KBM5 clones (labeled 1-5) with heterozygous precise correction of the ASXL1 mutation. Right-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, and KBM5 clones (labeled 1-5) with homozygous precise correction of the ASXL1 mutation. Beta-actin was used as loading control. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/6392) licensed under a CC-BY licence.
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, IP
CCR7 Antibody
(150503) [Unconjugate
MAB197
CCR7 Antibody (150503) [Unconjugated]
(2 Reviews)
(79 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot: SCL/Tal1 Antibody (5H1) [NBP2-01488] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Tal1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Tal1.
Immunocytochemistry/Immunofluorescence: SCL/Tal1 Antibody (5H1) [NBP2-01488] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Tal1.
Immunohistochemistry-Paraffin: SCL/Tal1 Antibody (5H1) [NBP2-01488] - Staining of paraffin-embedded Human prostate tissue using anti-Tal1 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(22 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
SAP155 Antibody
(JB40-32)
NBP2-75656
Western Blot: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of SF3B1 on different lysates using anti-SF3B1 antibody at 1/500 dilution.Positive control:Lane 1: Mouse thymus Lane 2: Hela
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded rat brain tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded human colon cancer tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GATA-1 Antibody
(4F5)
NBP1-47492
Western Blot: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis using GATA1 mouse mAb against K562 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
CBFB Antibody
NBP1-87300
Western Blot: CBFB Antibody [NBP1-87300] - Analysis in control (vector only transfected HEK293T lysate) and CBFB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: CBFB Antibody [NBP1-87300] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: CBFB Antibody [NBP1-87300] - Staining of human colon shows moderate membranous positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(44 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
LIS1 Antibody
NBP1-87769
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
(2 Reviews)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RUNX1/CBFA2 Antibody (NBP1-89105)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RUNX1/CBFA2 Antibody (NBP1-89105) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89105:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge 		3
reviewed by:
Anonymous
 WB Human 06/17/2013
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 whole cell lysate
SpeciesHuman
LotB81262
CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Blocking

Blocking Detailsblocked in 10% powdered milk, 1 hour at room temp.

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP linked
Secondary Manufacturer Cat#Cell signaling 7074
Secondary Concentration1:2500

Comments

CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (NBP1-89105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RUNX1/CBFA2 Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (NBP1-89105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover more about diseases related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Pathways for RUNX1/CBFA2 Antibody (NBP1-89105)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (NBP1-89105)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Research Areas for RUNX1/CBFA2 Antibody (NBP1-89105)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge
 Anonymous
06/17/2013
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol RUNX1
Entrez