Home » RUNX1/CBFA2 » RUNX1/CBFA2 Antibodies » RUNX1/CBFA2 Antibody

RUNX1/CBFA2 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human lymphoid tissues shows moderate to strong nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

RUNX1/CBFA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
Localization
Nucleus
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100. WB and IHC reacitivity reported in (PMID: 24967588).
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RUNX1/CBFA2 Recombinant Protein Antigen (NBP1-89105PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-89105 in the following applications:
Publications
Read Publication using
NBP1-89105 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24967588).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNX1/CBFA2 Antibody

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUNX1T1/ETO
Antibody
NBP2-55747
Immunocytochemistry/Immunofluorescence: RUNX1T1/ETO Antibody [NBP2-55747] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: RUNX1T1/ETO Antibody [NBP2-55747] - H2135 and H2087 non-small cell lung cancer cells showing baseline Runx1T1 expression versus Runx1T1 stable overexpression. Image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ETV6/Tel Antibody
NBP1-80695
Western Blot: ETV6/Tel Antibody [NBP1-80695] - Analysis in human cell lines U2OS and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: ETV6/Tel Antibody [NBP1-80695] - Staining of human kidney shows low expression as expected.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EVI-1 Antibody
NBP2-48848
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: EVI-1 Antibody [NBP2-48848] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
RUNX2/CBFA1 was detected in immersion fixed U2OS human osteosarcoma cell line using Rat Anti-Human RUNX2/CBFA1 Monoclonal Antibody (Catalog # MAB2006) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red, upper panel; Catalog # NL013) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(18 Publications)
Species: Hu
Applications: ICC
RUNX3/CBFA3
Antibody (527327) [Un ...
MAB3765
RUNX3/CBFA3 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Daudi human Burkitt's lymphoma cell line, and DA3 mouse myeloma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc). PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for RUNX3/CBFA3 at approximately 48 and 52  kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.5 mg/mL. A specific band was detected for RUNX3/CBFA3 at approximately 54 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse RUNX3/CBFA3 Monoclonal Antibody (Catalog # MAB3765). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
CBF2 Antibody
NBP2-47525
Immunohistochemistry: CBF2 Antibody [NBP2-47525] - Analysis of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: CBF2 Antibody [NBP2-47525] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2
(2 Reviews)
Species: Hu
Applications: IHC, IHC-P, WB
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Flt-3/Flk-2/CD135
Antibody (7E8.2C8) - ...
NBP2-80739
Western Blot: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) - Azide and BSA Free [NBP2-80739] - WB analysis of lysates from (A) Human Embryonic Kidney 293 / HEK293 and (B) Human Embryonic carcinoma NCCIT cell lines using Flt-3/Flk-2/CD135 antibody (clone 7E8.2C8) at 2ug/ml concentration. The antibody detected single specific bands in both samples at the expected molecular weight position. Image from the standard format of this antibody.
Flow Cytometry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) - Azide and BSA Free [NBP2-80739] - HEK293 cells were stained (surface) with Flt-3/Flk-2/CD135 antibody (clone: 7E8.2C8; red) or isotype control (mouse IgG2 lambda; blue) and positive staining observed using PE conjugated mouse anti-IgG(H+L) secondary antibody. Live cells (PPI negative) were gated for analysis Image from the standard format of this antibody.
Immunocytochemistry: Flt-3/Flk-2/CD135 Antibody (7E8.2C8) - Azide and BSA Free [NBP2-80739] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver cancer using Flt-3/Flk-2/CD135 antibody (clone 7E2.2C8) at 15 ug/ml concentration. The antibody generated specific cytoplasmic immunostaining of FLT3 in the cancerous cells w
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, IHC-P, WB
ASXL1 Antibody
(6E2)
H00171023-M05
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction. Evaluation of ASXL1 protein expression by Western blotting. Left-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), and KBM5 clones (labeled 1-5) with heterozygous precise correction of the ASXL1 mutation. Right-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, and KBM5 clones (labeled 1-5) with homozygous precise correction of the ASXL1 mutation. Beta-actin was used as loading control. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/6392) licensed under a CC-BY licence.
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: ELISA, IP, WB
CCR7 Antibody
(150503) [Unconjugate
MAB197
CCR7 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using 25 µg/mL Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
CCR7 was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in macrophages. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Recombinant Human CCL19/MIP‑3 beta (Catalog # 361‑MI) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR7 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL19/MIP‑3 beta (50 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human CCR7 Monoclonal Antibody (Catalog # MAB197). The ND50 is typically 1-5 µg/mL.
(3 Reviews)
(83 Publications)
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot: SCL/Tal1 Antibody (5H1) [NBP2-01488] - Analysis of extracts (10ug) from 2 different cell lines by using anti-TAL1 monoclonal antibody at 1:200.
Flow Cytometry: SCL/Tal1 Antibody (5H1) [NBP2-01488] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Tal1 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: SCL/Tal1 Antibody (5H1) [NBP2-01488] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Tal1.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SAP155 Antibody
(JB40-32)
NBP2-75656
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded human colon cancer tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded human skin tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded human kidney tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
GATA-1 Antibody
(4F5)
NBP1-47492
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
CBFB Antibody
AF7349
Western blot shows lysates of M1 mouse myeloid leukemia cell line and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CBFB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7349) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CBFB at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CBFB was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Sheep Anti-Human/Mouse CBFB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7349) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu
Applications: ICC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
LIS1 Antibody
NBP1-87769
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RUNX1/CBFA2 Antibody (NBP1-89105)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RUNX1/CBFA2 Antibody (NBP1-89105) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89105:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge 		3
reviewed by:
Verified Customer
 WB Human 06/17/2013
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 whole cell lysate
SpeciesHuman
LotB81262
CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Blocking

Blocking Detailsblocked in 10% powdered milk, 1 hour at room temp.

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP linked
Secondary Manufacturer Cat#Cell signaling 7074
Secondary Concentration1:2500

Comments

CommentsThe antibody accurately bound to the overexpressed human Runx1b protein, although it picked up several bands of non-specific staining, or staining of endogenous Runx1 protein variants or breakdown products.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (NBP1-89105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1/CBFA2 Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (NBP1-89105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (NBP1-89105)

Discover more about diseases related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Pathways for RUNX1/CBFA2 Antibody (NBP1-89105)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (NBP1-89105)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (NBP1-89105).
 

Research Areas for RUNX1/CBFA2 Antibody (NBP1-89105)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Western Blot RUNX1/CBFA2 NBP1-89105
Enlarge
 Verified Customer
06/17/2013
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol RUNX1
Entrez