alpha-Internexin Antibody - BSA Free

Western Blot: alpha-Internexin Antibody [NBP1-81007] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: alpha-Internexin Antibody [NBP1-81007] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & intermediate filaments.

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining in human cerebral cortex and kidney tissues . Corresponding INA RNA-seq data are presented for the same tissues.

Western Blot: alpha-Internexin Antibody [NBP1-81007] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: alpha-Internexin Antibody [NBP1-81007] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of mouse brain shows moderate positivity in of in the hippocampus.

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of mouse brain shows positivity in the cerebral cortex.

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human cerebellum shows positivity in purkinje cells.

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human cerebral cortex shows positivity in neuropil.

Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human kidney shows very weak cytoplasmic positivity.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-Internexin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit alpha-Internexin Antibody - BSA Free (NBP1-81007) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-alpha-Internexin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ
• Marker: Immature Neuronal Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 21246521). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha-Internexin Antibody - BSA Free

• 66 kDa neurofilament protein
• alphaInternexin
• alpha-Internexin
• alpha-Inx
• FLJ18662
• FLJ57501
• INA
• internexin neuronal intermediate filament protein, alpha
• MGC12702
• NEF5
• neurofilament 5 (66kD)
• Neurofilament 5
• Neurofilament-66
• neurofilament-66, tax-binding protein
• NF-66
• NF-66alpha-internexin
• TXBP-1

Background

Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.

The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha-Internexin Antibody (NBP1-81007)(2)

Publications using NBP1-81007

• Mokhtari K, Ducray F, Kros J et al. Alpha-internexin expression predicts outcome in anaplastic oligodendroglial tumors and may positively impact the efficacy of chemotherapy: European organization for research and treatment of cancer trial 26951 Cancer 2011-07-01 [PMID: 21246521] (IF/IHC, Human)
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: INA
• Entrez:
  • 9118(Human)
• Uniprot:
  • Q16352(Human)