Western Blot: alpha-Internexin Antibody [NBP1-81007] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody [NBP1-81007] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & intermediate filaments.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining in human cerebral cortex and kidney tissues . Corresponding INA RNA-seq data are presented for the same ...read more
Western Blot: alpha-Internexin Antibody [NBP1-81007] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: alpha-Internexin Antibody [NBP1-81007] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of mouse brain shows moderate positivity in of in the hippocampus.
Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of mouse brain shows positivity in the cerebral cortex.
Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human cerebellum shows positivity in purkinje cells.
Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human cerebral cortex shows positivity in neuropil.
Immunohistochemistry-Paraffin: alpha-Internexin Antibody [NBP1-81007] - Staining of human kidney shows very weak cytoplasmic positivity.
This antibody was developed against Recombinant Protein corresponding to amino acids: ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ
Marker
Immature Neuronal Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC reported in scientific literature (PMID: 21246521). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.
The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for alpha-Internexin Antibody (NBP1-81007) (0)
There are no reviews for alpha-Internexin Antibody (NBP1-81007).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our alpha-Internexin Antibody - BSA Free and receive a gift card or discount.