alpha-Internexin Antibody (5E5Z3)

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Western blot analysis of extracts of various cell lines, using alpha-Internexin Rabbit mAb (NBP3-16230) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded mouse brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human appendix tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded rat brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human colon tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded mouse brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded rat brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 5E5Z3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

alpha-Internexin Antibody (5E5Z3) Summary

• Description: Novus Biologicals Rabbit alpha-Internexin Antibody (5E5Z3) (NBP3-16230) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human alpha-Internexin (Q16352). EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: INA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha-Internexin Antibody (5E5Z3)

• 66 kDa neurofilament protein
• alphaInternexin
• alpha-Internexin
• alpha-Inx
• FLJ18662
• FLJ57501
• INA
• internexin neuronal intermediate filament protein, alpha
• MGC12702
• NEF5
• neurofilament 5 (66kD)
• Neurofilament 5
• Neurofilament-66
• neurofilament-66, tax-binding protein
• NF-66
• NF-66alpha-internexin
• TXBP-1

Background

Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.

The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INA