alpha 2-Macroglobulin Antibody (7V6M10)

Western Blot: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Analysis of extracts of HepG2 cells, using Alpha-2-Macroglobulin (alpha 2-Macroglobulin) Rabbit mAb (NBP3-16875) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Human cervix cancer tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Human tonsil tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Mouse brain tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Rat spleen tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Immunofluorescence analysis of paraffin-embedded human liver using Alpha-2-Macroglobulin ) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Immunofluorescence analysis of paraffin-embedded mouse liver using Alpha-2-Macroglobulin ) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Immunofluorescence analysis of paraffin-embedded rat liver using Alpha-2-Macroglobulin ) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: alpha 2-Macroglobulin Antibody (7V6M10) [NBP3-16875] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Alpha-2-Macroglobulin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [alpha 2-Macroglobulin] - Immunofluorescence analysis of paraffin-embedded rat liver using Alpha-2-Macroglobulin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [alpha 2-Macroglobulin] - Immunofluorescence analysis of paraffin-embedded mouse liver using Alpha-2-Macroglobulin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: alpha 2-Macroglobulin Antibody (7V6M10) [alpha 2-Macroglobulin] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using alpha 2-Macroglobulin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: alpha 2-Macroglobulin Antibody (7V6M10) [alpha 2-Macroglobulin] - Immunofluorescence analysis of paraffin-embedded human liver using Alpha-2-Macroglobulin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 7V6M10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

alpha 2-Macroglobulin Antibody (7V6M10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human alpha 2-Macroglobulin (P01023). QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: A2M
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 185 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha 2-Macroglobulin Antibody (7V6M10)

• A2M
• alpha 2Macroglobulin
• alpha 2-Macroglobulin
• alpha-2-M
• alpha-2-macroglobulin
• C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
• CPAMD5
• CPAMD5DKFZp779B086
• FWP007
• S863-7

Background

Alpha 2 macroglobulin is a serum protein which is mainly synthesised in the liver. It functions as a broad range irreversible proteinase inhibitor that forms a "trap" around most proteases. Alpha 2 macroglobulin is is a tetrameric molecule, and with a molecular weight of 720 kDa, it so large a molecule that it tends to remain intravascular. Following conformational change, the protinase is deposited within a central cavity where it is still active but prevented from further contact with its substrate. Removal of the complex is mediated by the generation of recognition sites which react with receptors on a variety of cells including macrophages and liver cells. Alpha 2 macroglobulin is localized on the surface of peripheral blood lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: A2M