AKR1B1 Antibody - BSA Free

Western Blot: AKR1B1 Antibody [NBP1-53144] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate

Immunohistochemistry: AKR1B1 Antibody [NBP1-53144] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: AKR1B1 Antibody [NBP1-53144] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AKR1B1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AKR1B1(aldo-keto reductase family 1, member B1 (aldose reductase)) The peptide sequence was selected from the N terminal of AKR1B1. Peptide sequence ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKR1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AKR1B1 Antibody - BSA Free

• ADR
• Aldehyde reductase
• Aldo-keto reductase family 1 member B1
• aldo-keto reductase family 1, member B1 (aldose reductase)
• ALDR1aldose reductase
• ALR2
• ARaldehyde reductase 1
• EC 1.1.1
• EC 1.1.1.21
• Lii5-2 CTCL tumor antigen
• low Km aldose reductase
• MGC1804

Background

AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AKR1B1 Antibody (NBP1-53144)(1)

Publication using NBP1-53144

• Steuber,H. J. Mol. Biol. 379 (5), 991-1016. 2008-01-01 [PMID: 18495158]

Bioinformatics

• Gene Symbol: AKR1B1
• Entrez:
  • 231(Human)
• Uniprot:
  • P15121(Human)