AKR1B1 Antibody

Images

 
Western Blot: AKR1B1 Antibody [NBP1-53144] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate
Immunohistochemistry: AKR1B1 Antibody [NBP1-53144] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 ...read more
Western Blot: AKR1B1 Antibody [NBP1-53144] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKR1B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to AKR1B1(aldo-keto reductase family 1, member B1 (aldose reductase)) The peptide sequence was selected from the N terminal of AKR1B1. Peptide sequence ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against AKR1B1 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-53144.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AKR1B1 Antibody

  • ADR
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member B1
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • ALDR1aldose reductase
  • ALR2
  • ARaldehyde reductase 1
  • EC 1.1.1
  • EC 1.1.1.21
  • Lii5-2 CTCL tumor antigen
  • low Km aldose reductase
  • MGC1804

Background

AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for AKR1B1 Antibody (NBP1-53144)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-53144 Applications Species
Steuber,H. J. Mol. Biol. 379 (5), 991-1016. 2008 [PMID: 18495158]

Reviews for AKR1B1 Antibody (NBP1-53144) (0)

There are no reviews for AKR1B1 Antibody (NBP1-53144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR1B1 Antibody (NBP1-53144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKR1B1 Products

Bioinformatics Tool for AKR1B1 Antibody (NBP1-53144)

Discover related pathways, diseases and genes to AKR1B1 Antibody (NBP1-53144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1B1 Antibody (NBP1-53144)

Discover more about diseases related to AKR1B1 Antibody (NBP1-53144).
 

Pathways for AKR1B1 Antibody (NBP1-53144)

View related products by pathway.

PTMs for AKR1B1 Antibody (NBP1-53144)

Learn more about PTMs related to AKR1B1 Antibody (NBP1-53144).
 

Research Areas for AKR1B1 Antibody (NBP1-53144)

Find related products by research area.

Blogs on AKR1B1

There are no specific blogs for AKR1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKR1B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B1
Entrez
Uniprot