Aconitase 1 Antibody

Images

 
Immunohistochemistry: Aconitase 1 Antibody [NBP1-87678] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aconitase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aconitase 1 Protein (NBP1-87678PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15245
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Aconitase 1 Antibody (NBP1-87678) (0)

There are no publications for Aconitase 1 Antibody (NBP1-87678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aconitase 1 Antibody (NBP1-87678) (0)

There are no reviews for Aconitase 1 Antibody (NBP1-87678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aconitase 1 Antibody (NBP1-87678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (NBP1-87678)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (NBP1-87678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (NBP1-87678)

Discover more about diseases related to Aconitase 1 Antibody (NBP1-87678).
 

Pathways for Aconitase 1 Antibody (NBP1-87678)

View related products by pathway.

PTMs for Aconitase 1 Antibody (NBP1-87678)

Learn more about PTMs related to Aconitase 1 Antibody (NBP1-87678).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aconitase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACO1