NRAMP2/SLC11A2/DMT1 Antibody (4C6)


Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P

Order Details

NRAMP2/SLC11A2/DMT1 Antibody (4C6) Summary

SLC11A2 (NP_000608, 1 a.a. - 65 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for IHC-P and ELISA.
Read Publications using
H00004891-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody (4C6)

  • DCT1
  • Divalent cation transporter 1
  • Divalent metal transporter 1
  • DMT-1
  • DMT1FLJ37416
  • member 2
  • NRAMP2
  • NRAMP2natural resistance-associated macrophage protein 2
  • SLC11A2
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)


The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)(6)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01) (0)

There are no reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01). (Showing 1 - 1 of 1 FAQs).

  1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
    • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="" target="_self">Innovators Reward Program</a>.

Secondary Antibodies


Isotype Controls

Additional NRAMP2/SLC11A2/DMT1 Products

Bioinformatics Tool for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)

Discover related pathways, diseases and genes to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)

Discover more about diseases related to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01).

Pathways for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)

View related products by pathway.

PTMs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)

Learn more about PTMs related to NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01).

Blogs on NRAMP2/SLC11A2/DMT1

There are no specific blogs for NRAMP2/SLC11A2/DMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NRAMP2/SLC11A2/DMT1 Antibody (4C6) and receive a gift card or discount.


Gene Symbol SLC11A2