Home » DMRT1 » DMRT1 Antibodies » DMRT1 Antibody

DMRT1 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Analysis in human testis and fallopian tube tissues. Corresponding DMRT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

DMRT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Specificity
Specificity of human DMRT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
IHC reported in scientific literature (PMID: 30067948). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DMRT1 Protein (NBP1-84071PEP)
Publications
Read Publications using
NBP1-84071 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMRT1 Antibody

  • DM domain expressed in testis 1
  • DMT1DM domain expressed in testis protein 1
  • doublesex and mab-3 related transcription factor 1
  • doublesex- and mab-3-related transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), and ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20uM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-27107-8) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
(9 Publications)
Species: Hu, Mu, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA

Ferroportin/SLC40A1 An
NBP1-21502
Western Blot: Ferroportin/SLC40A1 Antibody [NBP1-21502] - Western blot of human intestine lysate (Molecular weight: 62.5 KDa) using Ferroportin/SLC40A1 Antibody.
Western Blot: Ferroportin/SLC40A1 Antibody [NBP1-21502] - Duodenal mucosa samples from weanling pigs with iron replete or iron deficient status were probed using Ferroportin/SLC40A1 Antibody(NBP1-21502; 1:1000 dilution) and GAPDH (loading control). Image from verified customer review.
Flow Cytometry: Ferroportin/SLC40A1 Antibody [NBP1-21502] - An intracellular stain was performed on HepG2 cells with Ferroportin/SLC40A1 Antibody and a matched isotype control. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(7 Reviews)
(88 Publications)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Holo-Transferrin
2914-HT
Holo-Transferrin
(2 Reviews)
(17 Publications)
Species: Hu
Cytochrome b
reductase 1 Antibody
NB300-914
Immunohistochemistry-Paraffin: Cytochrome b reductase 1 Antibody [NB300-914] - Staining of paraffin embedded Human Small Intestine. Antibody at 2.5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: Cytochrome b reductase 1 Antibody [NB300-914] - Staining of paraffin embedded Human Testis. Antibody at 2.5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
Hepcidin
Antimicrobial Peptide
NBP1-59337
Western Blot: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Human Spleen lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: Hepcidin Antimicrobial Peptide Antibody [NBP1-59337] - Paraffin embedded sections of posterior segment of mouse eye, red is Hepcidin and blue is Hoeschst. 4um sections were rehydrated with xylene, followed by a decreasing ethanol concentration gradient (100%, 90%, 70%) and a wash with diH2O. Heat-mediated antigen retrieval performed using EDTA buffer (10mM Trizma Base, 1mM EDTA solution, 0.05% Tween 20, pH 9.0) in an autoclave for 30min. Primary antibody against Hepcidin was diluted 1:10, in blocking solution containing 0.1% BSA, 0.05% Triton X-100, and 5% normal donkey serum in TBS. Sections were incubated for 48hrs at room temperature and then 24hrs at 4C. Tissues were washed with TBS-T (6x5min), and immunoreactivity for Hep was developed. Image from verified customer review.
(6 Reviews)
(2 Publications)
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Hephaestin Antibody
NBP1-85483
Immunohistochemistry-Paraffin: Hephaestin Antibody [NBP1-85483] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
NRAMP1/SLC11A1
Antibody (910825)
MAB8400
Western blot shows lysates of HEK293 human embryonic kidney cell line either mock transfected or transfected with human NRAMP1/SLC11A1. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human NRAMP1/SLC11A1 Monoclonal Antibody (Catalog # MAB8400) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for NRAMP1/SLC11A1 at approximately 90-120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HEK293 human embryonic kidney cell line transfected with either (A) human NRAMP1/SLC11A1 or (B) irrelevant transfectants and eGFP was stained with Mouse Anti-Human NRAMP1/SLC11A1 Monoclonal Antibody (Catalog # MAB8400) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). Quadrant markers were set based on control antibody staining (Catalog # MAB0041).
Species: Hu
Applications: WB, Flow, CyTOF-ready

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SOX9 Antibody
[Unconjugated]
AF3075
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, KATO‑III human gastric carcinoma cell line, COLO 205 human colorectal adenocarcinoma cell line, and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX9 at approximately 75 kDa (as indicated). GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX9 was detected in immersion fixed HEK293 human embryonic kidney cell line using 10 µg/mL Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Reviews)
(42 Publications)
Species: Hu
Applications: WB, Simple Western, ICC
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - U2OS cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-Aromatase Antibody NB100-1596 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of control ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 200 um (1st image) and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(8 Publications)
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
SLC36A1 Antibody
NBP2-80524
SLC36A1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
SRY Antibody (1G4)
NBP2-37463
Western Blot: SRY Antibody (1G4) [NBP2-37463] - Analysis using SRY mouse mAb against NTERA-2 (1) cell lysate.
Immunohistochemistry-Paraffin: SRY Antibody (1G4) [NBP2-37463] - Analysis of ovarian cancer tissues using SRY mouse mAb with DAB staining.
Flow Cytometry: SRY Antibody (1G4) [NBP2-37463] - Analysis of HepG2 cells using SRY mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Aconitase 1
Antibody
NBP1-87677
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY licence.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Human
Ceruloplasmin ELISA K ...
NBP2-60616
ELISA: Human Ceruloplasmin ELISA Kit (Colorimetric) [NBP2-60616]
Species: Hu
FOXL2 Antibody
NB100-1277
Western Blot: FOXL2 Antibody [NB100-1277] - Staining of K562 cell lysate (A) + peptide (B) and HeLa cell lysate (C) + peptide (D) 35 ug protein in RIPA buffer). FOXL2 antibody at 2 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: FOXL2 Antibody [NB100-1277] - Analysis of FOXL2 in PFA-fixed, E14.5 mouse ovary section using anti-FOXL2 antibody (magenta), germ cell marker (green) and hoechst (grey). ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: FOXL2 Antibody [NB100-1277] - Staining of paraffin embedded Human Adrenal Gland. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Review)
(42 Publications)
Species: Hu, Mu, Ma
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt

Publications for DMRT1 Antibody (NBP1-84071)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DMRT1 Antibody (NBP1-84071) (0)

There are no reviews for DMRT1 Antibody (NBP1-84071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DMRT1 Antibody (NBP1-84071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional DMRT1 Products

Bioinformatics Tool for DMRT1 Antibody (NBP1-84071)

Discover related pathways, diseases and genes to DMRT1 Antibody (NBP1-84071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMRT1 Antibody (NBP1-84071)

Discover more about diseases related to DMRT1 Antibody (NBP1-84071).
 

Pathways for DMRT1 Antibody (NBP1-84071)

View related products by pathway.

PTMs for DMRT1 Antibody (NBP1-84071)

Learn more about PTMs related to DMRT1 Antibody (NBP1-84071).

Blogs on DMRT1

There are no specific blogs for DMRT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMRT1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DMRT1