DMRT1 Antibody

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.

Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Analysis in human testis and fallopian tube tissues. Corresponding DMRT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DMRT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMRT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 30067948). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DMRT1 Protein (NBP1-84071PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DMRT1 Antibody

• DM domain expressed in testis 1
• DMT1DM domain expressed in testis protein 1
• doublesex and mab-3 related transcription factor 1
• doublesex- and mab-3-related transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DMRT1 Antibody (NBP1-84071)(4)

Publications using NBP1-84071

• Roth LM, Michal M, Michal M et al. Protein expression of the transcription factors DMRT1, TCLF5, and OCT4 in selected germ cell neoplasms of the testis Hum. Pathol. Jul 29 2018 [PMID: 30067948] (IHC, Human)
• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014 Jun [PMID: 24598113]
• von Kopylow K, Staege H, Schulze W et al. Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia. Histochem Cell Biol 2012 Nov [PMID: 22777346]
• von Kopylow K, Staege H, Spiess AN et al. Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia. Reproduction 2012 Jan [PMID: 22046055]

Bioinformatics

• Gene Symbol: DMRT1