DMRT1 Antibody

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.

Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Analysis in human testis and fallopian tube tissues. Corresponding DMRT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DMRT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMRT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 30067948). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DMRT1 Protein (NBP1-84071PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DMRT1 Antibody

• DM domain expressed in testis 1
• DMT1DM domain expressed in testis protein 1
• doublesex and mab-3 related transcription factor 1
• doublesex- and mab-3-related transcription factor 1

Background

DMRT1 is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DMRT1 Antibody (NBP1-84071)(4)

Publications using NBP1-84071

• Roth LM, Michal M, Michal M et al. Protein expression of the transcription factors DMRT1, TCLF5, and OCT4 in selected germ cell neoplasms of the testis Hum. Pathol. 2018-07-29 [PMID: 30067948] (IF/IHC, Human)
• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]
• von Kopylow K, Staege H, Schulze W et al. Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia. Histochem Cell Biol 2012-11-01 [PMID: 22777346]
• von Kopylow K, Staege H, Spiess AN et al. Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia. Reproduction 2012-01-01 [PMID: 22046055]

Bioinformatics

• Gene Symbol: DMRT1