DMRT1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented ...read more
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Analysis in human testis and fallopian tube tissues. Corresponding DMRT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DMRT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 30067948). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DMRT1 Protein (NBP1-84071PEP)
Publications
Read Publications using
NBP1-84071 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMRT1 Antibody

  • DM domain expressed in testis 1
  • DMT1DM domain expressed in testis protein 1
  • doublesex and mab-3 related transcription factor 1
  • doublesex- and mab-3-related transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-21502
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
DHP250
Species: Hu
Applications: ELISA
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1277
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB

Publications for DMRT1 Antibody (NBP1-84071)(4)

Reviews for DMRT1 Antibody (NBP1-84071) (0)

There are no reviews for DMRT1 Antibody (NBP1-84071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DMRT1 Antibody (NBP1-84071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMRT1 Products

Bioinformatics Tool for DMRT1 Antibody (NBP1-84071)

Discover related pathways, diseases and genes to DMRT1 Antibody (NBP1-84071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMRT1 Antibody (NBP1-84071)

Discover more about diseases related to DMRT1 Antibody (NBP1-84071).
 

Pathways for DMRT1 Antibody (NBP1-84071)

View related products by pathway.

PTMs for DMRT1 Antibody (NBP1-84071)

Learn more about PTMs related to DMRT1 Antibody (NBP1-84071).

Blogs on DMRT1

There are no specific blogs for DMRT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMRT1