Aconitase 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Analysis in human kidney and skeletal muscle tissues using NBP1-87677 antibody. Corresponding ACO1 RNA-seq data are presented for the same tissues.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of fatty acids on IRP1 expression in HepG2 hepatocytes. IRP1 protein levels were evaluated by Western Blotting. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1.A) Total IRP1 activity was measured by RNA band shift assay. B) Densitometric analysis of IRP1 activity. C) Hepatic IRP1 protein levels evaluated by Western Blotting. C) Densitometric analysis of IRP1 protein levels; beta -actin is shown as the loading control. D). Effect of HFD on IRP1 & IRP2 mRNA levels. Gene expression was evaluated by qRT-PCR. The figure is representative of results obtained in 6 animals per group in two independent experiments. Values are expressed as means±SD. AU, arbitrary units. *p<0.05 vs controls. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aconitase 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
• Control Peptide:

  Aconitase 1 Recombinant Protein Antigen (NBP1-87677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody - BSA Free

• aconitase 1, soluble
• Aconitase
• aconitate hydratase
• Citrate hydro-lyase
• cytoplasmic aconitate hydratase
• EC 4.2.1
• EC 4.2.1.3
• Ferritin repressor protein
• IREB1IREBP1
• IRE-BP 1
• IREBP
• Iron regulatory protein 1
• iron-responsive element binding protein 1
• Iron-responsive element-binding protein 1
• IRP1ACONS

Background

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aconitase 1 Antibody (NBP1-87677)(3)

Publications using NBP1-87677

• Gu W, Fillebeen C, Pantopoulos K. Human IRP1 Translocates to the Nucleus in a Cell-Specific and Iron-Dependent Manner International Journal of Molecular Sciences 2022-09-15 [PMID: 36142654]
• Dongiovanni P, Lanti C, Gatti S et al. High fat diet subverts hepatocellular iron uptake determining dysmetabolic iron overload PLoS ONE. 2015-02-04 [PMID: 25647178] (WB, Human, Rat)
  
  Details:
  Aconitase 1 / IRP1 antibody used for WB on lysates of liver tissues from Rats which were fed regular diet, high-fat diet/HFD or HFD supplemented with iron/HFD + Iron (Figure 4C). WB also performed on lysates of human HepG2 hepatocytes which were treated or not with palmitic acid/PA (0.66 mM: saturated, C16:0) and oleic acid/OA (1 mM: n-9 mono-unsaturated, C18:1, cis), PA + OA + ferric ammonium citrate (FAC, 150 uM) or FAC only (Figure 6A).
• Haro KJ, Sheth A, Scheinberg DA et al. Dysregulation of IRP1-Mediated Iron Metabolism Causes Gamma Ray-specific Radioresistance in Leukemia Cells. PLoS One 2012-01-01 [PMID: 23155415]

Reviews for Aconitase 1 Antibody (NBP1-87677) (2)

Average Rating: 2.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Mouse, Bovine and Chironomus riprius.

reviewed by: Nicholas Niemuth WB Bovine and Chironomus riprius 03/09/2020

Summary

• Application: Western Blot
• Sample Tested: Purified protein,Whole organism protein extract
• Species: Bovine and Chironomus riprius
• Lot: A105066

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Verified Customer WB Mouse 07/28/2014

Summary

• Application: Western Blot
• Sample Tested: mouse lung
• Species: Mouse

Bioinformatics

• Gene Symbol: ACO1