Aconitase 1 Antibody

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell line U-87 MG.

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and lymph node tissues using anti-ACO1 antibody. Corresponding ACO1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aconitase 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Specificity: Specificity of human, mouse, rat Aconitase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aconitase 1 Protein (NBP1-87677PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23155415)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

• aconitase 1, soluble
• Aconitase
• aconitate hydratase
• Citrate hydro-lyase
• cytoplasmic aconitate hydratase
• EC 4.2.1
• EC 4.2.1.3
• Ferritin repressor protein
• IREB1IREBP1
• IRE-BP 1
• IREBP
• Iron regulatory protein 1
• iron-responsive element binding protein 1
• Iron-responsive element-binding protein 1
• IRP1ACONS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aconitase 1 Antibody (NBP1-87677)(2)

Publications using NBP1-87677

• Dongiovanni P, Lanti C, Gatti S et al. High fat diet subverts hepatocellular iron uptake determining dysmetabolic iron overload PLoS ONE. 2015 Feb 04 [PMID: 25647178] (WB, Rat, Human)
  
  Details:
  Aconitase 1 / IRP1 antibody used for WB on lysates of liver tissues from Rats which were fed regular diet, high-fat diet/HFD or HFD supplemented with iron/HFD + Iron (Figure 4C). WB also performed on lysates of human HepG2 hepatocytes which were treated or not with palmitic acid/PA (0.66 mM: saturated, C16:0) and oleic acid/OA (1 mM: n-9 mono-unsaturated, C18:1, cis), PA + OA + ferric ammonium citrate (FAC, 150 uM) or FAC only (Figure 6A).
• Haro KJ, Sheth A, Scheinberg DA et al. Dysregulation of IRP1-Mediated Iron Metabolism Causes Gamma Ray-specific Radioresistance in Leukemia Cells. PLoS One 2012 [PMID: 23155415]

Review for Aconitase 1 Antibody (NBP1-87677) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Anonymous WB Mouse 07/28/2014

Summary

• Application: Western Blot
• Sample Tested: mouse lung
• Species: Mouse

Bioinformatics

• Gene Symbol: ACO1