Aconitase 1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of fatty acids on IRP1 expression in HepG2 hepatocytes. IRP1 protein levels were evaluated by Western Blotting. Image collected and cropped by CiteAb from the ...read more
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Aconitase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
WB reported in scientific literature (PMID: 25647178). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Aconitase 1 antibody validated for WB from a verified customer review. Simple Western was validated internally.
Control Peptide
Aconitase 1 Protein (NBP1-87677PEP)
Reviewed Applications
Read 2 Reviews rated 2.5
using
NBP1-87677 in the following applications:

Publications
Read Publications using
NBP1-87677 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Background

The insulin receptor substrate-1 (IRS-1), a major substrate of the insulin receptor, is phosphorylated in response to stimulation of cells by insulin, insulin-like growth factor 1 (IGF-1) and interleukin 4 (IL-4). IRS-1 is phosphorylated on serine, threonine and tyrosine residues in a variety of tissues. An insulin-sensitive serine/threonine kinase casein kinase II mediates a portion of the insulin-stimulated serine/threonine phosphorylation of overexpressed IRS-1 in vivo. Thr 502 is identified as the major casein kinase II-catalyzed phosphorylation site in rat IRS-1, and Ser 99 is an additional phosphorylation site catalyzed by casein kinase II. Thus, casein kinase II-catalyzed phosphorylation of IRS-1 may be a component of the intracellular insulin signaling cascade. IRS-1 contains three putative binding sites for 14-3-3 (Ser 270, Ser 374 and Ser 641) and the motif around Ser 270 is located in the phosphortyrosine binding domain of IRS-1, which is responsible for the interaction with the insulin receptor. The association of 14-3-3 with IRS-1 increases significantly upon treatment with okadaic acid, a potent serine/ threonine phosphatase inhibitor. Therefore, the association of 14-3-3 protein may play a role in the regulation of insulin sensitivity by interrupting the association between the insulin receptor and IRS-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1798
Species: Hu, Mu
Applications: GS, ICC/IF, IHC, IHC-P, WB
AF3464
Species: Hu
Applications: IHC, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-84071
Species: Hu
Applications: IHC, IHC-P, WB
MAB7509
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-02241
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Aconitase 1 Antibody (NBP1-87677)(2)

Reviews for Aconitase 1 Antibody (NBP1-87677) (2) 2.52

Average Rating: 2.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Bovine and Chironomus riprius.

Reviews using NBP1-87677:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Mouse
(1)
Bovine and Chironomus riprius
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Aconitase 1 NBP1-87677
Enlarge
1
reviewed by:
Verified Customer
WB Bovine and Chironomus riprius 03/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedPurified protein,Whole organism protein extract
SpeciesBovine and Chironomus riprius
LotA105066

Comments

Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.
  4
reviewed by:
Kristen Rooney
WB Mouse 07/28/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse lung
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aconitase 1 Antibody (NBP1-87677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (NBP1-87677)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (NBP1-87677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (NBP1-87677)

Discover more about diseases related to Aconitase 1 Antibody (NBP1-87677).
 

Pathways for Aconitase 1 Antibody (NBP1-87677)

View related products by pathway.

PTMs for Aconitase 1 Antibody (NBP1-87677)

Learn more about PTMs related to Aconitase 1 Antibody (NBP1-87677).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.5
5
0
4
1
3
0
2
0
1
1

Verified Customer
03/09/2020
Application: WB
Species: Bovine and Chironomus riprius

 
Kristen Rooney
07/28/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol ACO1