Aconitase 1 Antibody

Images

 
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong positivity in renal tubules.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell line U-87 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aconitase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aconitase 1 Protein (NBP1-87677PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87677 in the following applications:

Publications
Read Publications using
NBP1-87677 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23155415)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15245
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Aconitase 1 Antibody (NBP1-87677)(2)

Review for Aconitase 1 Antibody (NBP1-87677) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87677:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Mouse 07/28/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse lung
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aconitase 1 Antibody (NBP1-87677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (NBP1-87677)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (NBP1-87677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (NBP1-87677)

Discover more about diseases related to Aconitase 1 Antibody (NBP1-87677).
 

Pathways for Aconitase 1 Antibody (NBP1-87677)

View related products by pathway.

PTMs for Aconitase 1 Antibody (NBP1-87677)

Learn more about PTMs related to Aconitase 1 Antibody (NBP1-87677).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
07/28/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol ACO1