Home » Aconitase 1 » Aconitase 1 Antibodies » Aconitase 1 Antibody

Aconitase 1 Antibody

 (2 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of fatty acids on IRP1 expression in HepG2 hepatocytes. IRP1 protein levels were evaluated by Western Blotting. Image collected and cropped by CiteAb from the ...read more
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Aconitase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
WB reported in scientific literature (PMID: 25647178). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Aconitase 1 antibody validated for WB from a verified customer review. Simple Western was validated internally.
Control Peptide
Aconitase 1 Protein (NBP1-87677PEP)
Reviewed Applications
Read 2 Reviews rated 2.5
using
NBP1-87677 in the following applications:
Publications
Read Publications using
NBP1-87677 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Background

The insulin receptor substrate-1 (IRS-1), a major substrate of the insulin receptor, is phosphorylated in response to stimulation of cells by insulin, insulin-like growth factor 1 (IGF-1) and interleukin 4 (IL-4). IRS-1 is phosphorylated on serine, threonine and tyrosine residues in a variety of tissues. An insulin-sensitive serine/threonine kinase casein kinase II mediates a portion of the insulin-stimulated serine/threonine phosphorylation of overexpressed IRS-1 in vivo. Thr 502 is identified as the major casein kinase II-catalyzed phosphorylation site in rat IRS-1, and Ser 99 is an additional phosphorylation site catalyzed by casein kinase II. Thus, casein kinase II-catalyzed phosphorylation of IRS-1 may be a component of the intracellular insulin signaling cascade. IRS-1 contains three putative binding sites for 14-3-3 (Ser 270, Ser 374 and Ser 641) and the motif around Ser 270 is located in the phosphortyrosine binding domain of IRS-1, which is responsible for the interaction with the insulin receptor. The association of 14-3-3 with IRS-1 increases significantly upon treatment with okadaic acid, a potent serine/ threonine phosphatase inhibitor. Therefore, the association of 14-3-3 protein may play a role in the regulation of insulin sensitivity by interrupting the association between the insulin receptor and IRS-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRP2 Antibody
NB100-1798
Immunohistochemistry-Paraffin: IRP2 Antibody [NB100-1798] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human placenta using 1:300 conc. of IRP2 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 30 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 9.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 15 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Cytoplasmic staining was observed in villi of endothelial cells.
Western Blot: IRP2 Antibody [NB100-1798] - Detection of IRP2 in mouse liver lysate.
Western Blot: IRP2 Antibody [NB100-1798] - Detection of IRP2 in RAW 264.7 lysate using NB100-1798. Lane 1: Lot B Lane 2: Lot C
(8 Publications)
Species: Hu, Mu
Applications: GS, ICC/IF, IHC, IHC-P, WB
Wnt-2 Antibody
AF3464
Western blot shows lysates of human brain (hypothalamus) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Wnt‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3464) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Wnt‑2 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Wnt‑2 was detected in immersion fixed paraffin-embedded sections of human stomach cancer tissue using 10 µg/mL Goat Anti-Human Wnt‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3464) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
Fumarase Antibody
NBP1-31336
Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-31336] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: Fumarate hydratase protein stained by Fumarate hydratase antibody diluted at 1:500.Blue: Hoechst 33342 staining.
Western Blot: Fumarase Antibody [NBP1-31336] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Fumarate hydratase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Fumarase Antibody [NBP1-31336] - Representative western blots showing protein expression of fumarase and key enzymes in OXPHOS. VDAC was used as a loading control (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/srep22788) licensed under a CC-BY licence.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: ME1 Antibody [NBP1-32398] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
ME2 Antibody
NBP1-89559
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
ME3 Antibody
NBP3-05078
Immunocytochemistry/Immunofluorescence: ME3 Antibody [NBP3-05078] - Analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: ME3 Antibody [NBP3-05078] - Analysis of extracts of various cell lines, using ME3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Mouse heart using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Holo-Transferrin
2914-HT
Holo-Transferrin
(37 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
SOD2/Mn-SOD
Antibody
NB100-1992
Immunohistochemistry: SOD2/Mn-SOD Antibody [NB100-1992] - The effects of a high calcium/phosphate diet, of 1,25(OH)2D3, and of antioxidant supplementation on oxidative stress, DNA damage, and protein expression of oncogenes and tumor suppressive genes in 1alpha(OH)ase -/- mice. Mice from each group were treated as described in Figure 1. Representative micrographs of skin sections stained immunohistochemically for SOD2 and gamma-H2AX. Scale bars represent 50 um. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/acel.12951), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: SOD2/Mn-SOD Antibody [NB100-1992] - Analysis using Rabbit Anti-SOD (Mn) Polyclonal Antibody. Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-SOD (Mn) Polyclonal Antibody at 1:120 for 12 hours at 4 degrees C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 120 min at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 120 min at RT. Localization: Mitochondrion matrix. Magnification: 100x. (A) DAPI (blue) nuclear stain. (B) Anti-SOD (Mn) Antibody. (C) Composite.
Immunocytochemistry/Immunofluorescence: SOD2/Mn-SOD Antibody [NB100-1992] - Analysis using Rabbit Anti-SOD (Mn) Polyclonal Antibody. Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-SOD (Mn) Polyclonal Antibody at 1:120 for 12 hours at 4 degrees C. Secondary Antibody: APC Goat Anti-Rabbit (red) at 1:200 for 120 min at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 120 min at RT. Localization: Mitochondrion matrix. Magnification: 20x. (A) DAPI (blue) nuclear stain. (B) Anti-SOD (Mn) Antibody. (C) Composite.
(38 Publications)
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Frataxin antibody, and then analyzed by flow cytometry.
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), and ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20uM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-27107-8) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
(9 Publications)
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(3 Reviews)
(90 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
DMRT1 Antibody
NBP1-84071
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining in human testis and fallopian tube tissues using anti-DMRT1 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CHMP2B Antibody
(791521) [Unconjugate
MAB7509
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human CHMP2B Monoclonal Antibody (Catalog # MAB7509) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for CHMP2B at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CHMP2B was detected in immersion fixed paraffin-embedded sections of human brain (medulla) using Mouse Anti-Human CHMP2B Monoclonal Antibody (Catalog # MAB7509) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Staining is shown at both high (upper panel) and low (lower panel) magnification, and specific staining was localized to neuronal cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of U2OS human osteosarcoma cell line and CHMP2B knockout U2OS cell line (KO). Nitrocellulose membrane was probed with 1.25 µg/mL of Mouse Anti-Human CHMP2B Monoclonal Antibody (Catalog # MAB7509) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody. A specific band was detected for CHMP2B at approximately 28 kDa (as indicated) in the parental U2OS cell line, but is not detectable in knockout U2OS cell line. The Ponceau stained transfer of the blot is shown. This experiment was conducted under reducing conditions. Image, protocol, and testing courtesy of YCharOS Inc. See ycharos.com for additional details.
(1 Publication)
Species: Hu
Applications: IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Aconitase 2
Antibody (OTI3G8)
NBP2-02241
Western Blot: Aconitase 2 Antibody (3G8) [NBP2-02241] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Aconitase 2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Aconitase 2.
Immunocytochemistry/Immunofluorescence: Aconitase 2 Antibody (3G8) [NBP2-02241] - Immunofluorescent staining of HepG2 cells using anti-Aconitase 2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody (3G8) [NBP2-02241] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-Aconitase 2 mouse monoclonal antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Aconitase 1 Antibody (NBP1-87677)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Aconitase 1 Antibody (NBP1-87677) (2) 2.52

Average Rating: 2.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Bovine and Chironomus riprius.

Reviews using NBP1-87677:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Mouse
(1)
Bovine and Chironomus riprius
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Aconitase 1 NBP1-87677
Enlarge 		1
reviewed by:
Verified Customer
 WB Bovine and Chironomus riprius 03/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedPurified protein,Whole organism protein extract
SpeciesBovine and Chironomus riprius
LotA105066

Comments

Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.
  4
reviewed by:
Kristen Rooney
 WB Mouse 07/28/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse lung
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aconitase 1 Antibody (NBP1-87677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (NBP1-87677)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (NBP1-87677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (NBP1-87677)

Discover more about diseases related to Aconitase 1 Antibody (NBP1-87677).
 

Pathways for Aconitase 1 Antibody (NBP1-87677)

View related products by pathway.

PTMs for Aconitase 1 Antibody (NBP1-87677)

Learn more about PTMs related to Aconitase 1 Antibody (NBP1-87677).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.5
5
0
4
1
3
0
2
0
1
1
Western Blot Aconitase 1 NBP1-87677
Enlarge
 Verified Customer
03/09/2020
Application: WB
Species: Bovine and Chironomus riprius
read this review
 
 Kristen Rooney
07/28/2014
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol ACO1