Home » Aconitase 1 » Aconitase 1 Antibodies » Aconitase 1 Antibody

Aconitase 1 Antibody

 (2 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY licence.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the ...read more
Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of fatty acids on IRP1 expression in HepG2 hepatocytes. IRP1 protein levels were evaluated by Western Blotting. Image collected and cropped by CiteAb from the ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining in human kidney and tonsil tissues.. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Aconitase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Specificity
Specificity of human Aconitase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 25647178). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Aconitase 1 antibody validated for WB from a verified customer review. Simple Western was validated internally.
Control Peptide
Aconitase 1 Protein (NBP1-87677PEP)
Reviewed Applications
Read 2 Reviews rated 2.5
using
NBP1-87677 in the following applications:
Publications
Read Publications using
NBP1-87677 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 1 Antibody

  • aconitase 1, soluble
  • Aconitase
  • aconitate hydratase
  • Citrate hydro-lyase
  • cytoplasmic aconitate hydratase
  • EC 4.2.1
  • EC 4.2.1.3
  • Ferritin repressor protein
  • IREB1IREBP1
  • IRE-BP 1
  • IREBP
  • Iron regulatory protein 1
  • iron-responsive element binding protein 1
  • Iron-responsive element-binding protein 1
  • IRP1ACONS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRP2 Antibody
NB100-1798
Western Blot: IRP2 Antibody [NB100-1798] - Raw macrophages (mouse) were either left untreated (lane 1) or treated overnight with 100mM DFO (lane 2) or 100mM hemin (lane 3). Proteins extracts were subjected to western blotting using IRP2 or b-actin antibodies diluted 1:500 in TBS-Tween.
Immunohistochemistry-Paraffin: IRP2 Antibody [NB100-1798] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human placenta using 1:300 conc. of IRP2 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 30 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 9.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 15 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Cytoplasmic staining was observed in villi of endothelial cells.
Western Blot: IRP2 Antibody [NB100-1798] - Detection of IRP2 in mouse liver lysate.
(6 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
Wnt-2 Antibody
AF3464
Western blot shows lysates of human brain (hypothalamus) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Wnt‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3464) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Wnt‑2 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Wnt‑2 was detected in immersion fixed paraffin-embedded sections of human stomach cancer tissue using 10 µg/mL Goat Anti-Human Wnt‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3464) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Fumarase Antibody
NBP1-31336
Western Blot: Fumarase Antibody [NBP1-31336] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Fumarate hydratase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-31336] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: Fumarate hydratase protein stained by Fumarate hydratase antibody diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-31336] - Analysis of paraffin-embedded NCIN87 xenograft, using fumarate hydratase antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: ME1 Antibody [NBP1-32398] - Paraffin-embedded human ovarian carcinoma. ME1 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
ME2 Antibody
NBP1-89559
Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human colon.
Western Blot: ME2 Antibody [NBP1-89559] - Analysis in human cell line Daudi.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
ME3 Antibody
NBP1-85871
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Species: Hu
Applications: WB, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Holo-Transferrin
2914-HT
Holo-Transferrin
(2 Reviews)
(16 Publications)
Species: Hu
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
SOD2/Mn-SOD
Antibody
NB100-1992
Immunohistochemistry: SOD2/Mn-SOD Antibody [NB100-1992] - The effects of a high calcium/phosphate diet, of 1,25(OH)2D3, and of antioxidant supplementation on oxidative stress, DNA damage, and protein expression of oncogenes and tumor suppressive genes in 1alpha(OH)ase -/- mice. Mice from each group were treated as described in Figure 1. Representative micrographs of skin sections stained immunohistochemically for SOD2 and gamma-H2AX. Scale bars represent 50 um. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/acel.12951), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: SOD2/Mn-SOD Antibody [NB100-1992] - Analysis using Rabbit Anti-SOD (Mn) Polyclonal Antibody. Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-SOD (Mn) Polyclonal Antibody at 1:120 for 12 hours at 4 degrees C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 120 min at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 120 min at RT. Localization: Mitochondrion matrix. Magnification: 100x. (A) DAPI (blue) nuclear stain. (B) Anti-SOD (Mn) Antibody. (C) Composite.
Western Blot: SOD2/Mn-SOD Antibody [NB100-1992] - Analysis of Rat Tissue lysates showing detection of SOD2 protein using Rabbit Anti-SOD2 Polyclonal Antibody. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-SOD2 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
(33 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, Gp, Ha, Pm, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Frataxin Antibody
(10E11)
NBP2-59478
Western Blot: Frataxin Antibody (10E11) [NBP2-59478] - Lane 1: 293T cell lysates, Lane 2: Frataxin transfected 293T cell lysates
Immunocytochemistry/Immunofluorescence: Frataxin Antibody (10E11) [NBP2-59478] - Analysis of Frataxin in A549 cell line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human Frataxin antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
(9 Publications)
Species: Hu, Mu, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
(3 Reviews)
(8 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
iNOS Antibody
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Lung tissue.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Heart tissue.
(3 Reviews)
(53 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
DMRT1 Antibody
NBP1-84071
Western Blot: DMRT1 Antibody [NBP1-84071] - Analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DMRT1 Antibody [NBP1-84071] - Staining of human fallopian tube shows low expression as expected.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
CHMP2B Antibody
[Unconjugated]
AF7509
Western blot shows lysates of human brain (hippocampus) tissue, human placenta tissue, rat brain tissue, and mouse placenta tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat CHMP2B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7509) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CHMP2B at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CHMP2B was detected in immersion fixed paraffin-embedded sections of human brain (medulla) using Sheep Anti-Human/Mouse/Rat CHMP2B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7509) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, IHC
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Aconitase 2
Antibody
NBP1-90264
Immunocytochemistry/Immunofluorescence: Aconitase 2 Antibody [NBP1-90264] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Western Blot: Aconitase 2 Antibody [NBP1-90264] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining in human heart muscle and liver tissues using NBP1-90264 antibody. Corresponding ACO2 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aconitase 1 Antibody (NBP1-87677)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Aconitase 1 Antibody (NBP1-87677) (2) 2.52

Average Rating: 2.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Bovine and Chironomus riprius.

Reviews using NBP1-87677:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Mouse
(1)
Bovine and Chironomus riprius
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Aconitase 1 NBP1-87677
Enlarge 		1
reviewed by:
Nicholas Niemuth
 WB Bovine and Chironomus riprius 03/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedPurified protein,Whole organism protein extract
SpeciesBovine and Chironomus riprius
LotA105066

Comments

Comments*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.
  4
reviewed by:
Anonymous
 WB Mouse 07/28/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse lung
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aconitase 1 Antibody (NBP1-87677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Aconitase 1 Products

Bioinformatics Tool for Aconitase 1 Antibody (NBP1-87677)

Discover related pathways, diseases and genes to Aconitase 1 Antibody (NBP1-87677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aconitase 1 Antibody (NBP1-87677)

Discover more about diseases related to Aconitase 1 Antibody (NBP1-87677).
 

Pathways for Aconitase 1 Antibody (NBP1-87677)

View related products by pathway.

PTMs for Aconitase 1 Antibody (NBP1-87677)

Learn more about PTMs related to Aconitase 1 Antibody (NBP1-87677).

Blogs on Aconitase 1

There are no specific blogs for Aconitase 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2.5
5
0
4
1
3
0
2
0
1
1
Western Blot Aconitase 1 NBP1-87677
Enlarge
 Nicholas Niemuth
03/09/2020
Application: WB
Species: Bovine and Chironomus riprius
read this review
 
 Anonymous
07/28/2014
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol ACO1