Acidic Calponin Antibody - BSA Free

Western Blot: Acidic Calponin Antibody [NBP3-37886] - Western blot analysis of various lysates using Acidic Calponin Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] - Immunofluorescence analysis of NIH/3T3 cells using Acidic Calponin Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] - Immunofluorescence analysis of U2OS cells using Acidic Calponin Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Acidic Calponin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Acidic Calponin Antibody - BSA Free (NBP3-37886) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human Acidic Calponin (NP_001830.1).
  
  Sequence:
  LAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Acidic Calponin Antibody - BSA Free

• calponin 3, acidic
• Calponin, acidic isoform
• calponin-3
• dJ639P13.2.2 (acidic calponin 3)

Background

Acidic Calponin, or CNN3 for short, consists of a 329 amino acid isoform that is 36 kDa, and is involved in the regulation of smooth muscle contraction. Current research is being conducted on the relationship between acidic calponin and several diseases and disorders, including aortic aneurysm and neuronitis. The protein is not associated with any pathways, but it does interact with the proteins FYN, SLX4, ATG5, LCP1, and EMD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNN3