Fibrillin 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining of human placenta shows distinct positivity in basal membranes.
In-situ Hybridization: Fibrillin 2 Antibody [NBP1-88169] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: U-2 OS

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P, ISH
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fibrillin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • In-situ Hybridization
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 26679090)
Control Peptide
Fibrillin 2 Protein (NBP1-88169PEP)
Publications
Read Publications using
NBP1-88169 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibrillin 2 Antibody

  • CCA
  • congenital contractural arachnodactyly
  • DA9
  • fibrillin 2
  • fibrillin 5
  • fibrillin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH

Publications for Fibrillin 2 Antibody (NBP1-88169)(2)

Reviews for Fibrillin 2 Antibody (NBP1-88169) (0)

There are no reviews for Fibrillin 2 Antibody (NBP1-88169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrillin 2 Antibody (NBP1-88169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibrillin 2 Products

Bioinformatics Tool for Fibrillin 2 Antibody (NBP1-88169)

Discover related pathways, diseases and genes to Fibrillin 2 Antibody (NBP1-88169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrillin 2 Antibody (NBP1-88169)

Discover more about diseases related to Fibrillin 2 Antibody (NBP1-88169).
 

Pathways for Fibrillin 2 Antibody (NBP1-88169)

View related products by pathway.

PTMs for Fibrillin 2 Antibody (NBP1-88169)

Learn more about PTMs related to Fibrillin 2 Antibody (NBP1-88169).
 

Research Areas for Fibrillin 2 Antibody (NBP1-88169)

Find related products by research area.

Blogs on Fibrillin 2

There are no specific blogs for Fibrillin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibrillin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBN2