Fibrillin 2 Antibody - BSA Free

Analysis in human cell lines U2OS and A-431 using Anti-FBN2 antibody. Corresponding FBN2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Analysis in human placenta and skeletal muscle tissues using HPA012853 antibody. Corresponding FBN2 RNA-seq data are presented for the same tissues.

Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fibrillin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Fibrillin 2 Antibody - BSA Free (NBP1-88169) is a polyclonal antibody validated for use in IHC and WB. Anti-Fibrillin 2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID 26679090)
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Fibrillin 2 Protein (NBP1-88169PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Fibrillin 2 Antibody - BSA Free

• CCA
• congenital contractural arachnodactyly
• DA9
• fibrillin 2
• fibrillin 5
• fibrillin-2

Background

The protein encoded by the Fibrillin 2 gene is a component of connective tissue microfibrils and may be involved in elastic fiberassembly. Mutations in this gene cause congenital contractural arachnodactyly. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fibrillin 2 Antibody (NBP1-88169)(2)

Publications using NBP1-88169

• Yabe Y, Hagiwara Y, Tsuchiya M et al. Decreased elastic fibers and increased proteoglycans in the ligamentum flavum of patients with lumbar spinal canal stenosis. J. Orthop. Res. 2015-12-17 [PMID: 26679090] (IHC-Fr, Human)
  
  Details:
  Fibrillin 2 antibody was used at 1:100 dilution for IHC-Fr analysis of formalin fixed sections from ligamentum flavum samples which were collected from lumbar spinal canal stenosis/LSCS and lumbar disc herniation /non-thickened flavum group (control) patients.?
• Bolander A, Agnarsdottir M, Stromberg S et al. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics Proteomics 2008-11-01 [PMID: 19287070]

Bioinformatics

• Gene Symbol: FBN2