LAMC2 Antibody (CL2980)

Images

 
Genetic Strategies: Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human skin shows moderate positivity in basement membrane of epidermis.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human fallopian tube shows moderate positivity in basement membrane of glandular cells.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human small intestine shows moderate positivity in basement membrane of glandular cells.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clone
CL2980
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LAMC2 Antibody (CL2980) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLEN
Specificity
Specificity of human, mouse LAMC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
LAMC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAMC2 Recombinant Protein Antigen (NBP2-42388PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for LAMC2 Antibody (CL2980)

  • BM600
  • BM600-100kDa
  • Cell-scattering factor 140 kDa subunit
  • CSF 140 kDa subunit
  • CSF
  • EBR2
  • EBR2A
  • Epiligrin subunit gamma
  • kalinin (105kD)
  • Kalinin subunit gamma
  • Kalinin/nicein/epiligrin 100 kDa subunit
  • kalinin-105kDa
  • ladsin (140kDa)
  • Ladsin 140 kDa subunit
  • LAMB2Tlaminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitzjunctional epidermolysis bullosa))
  • Laminin B2t chain
  • laminin subunit gamma-2
  • laminin, gamma 2
  • Laminin-5 subunit gamma
  • LAMNB2B2T
  • Large adhesive scatter factor 140 kDa subunit
  • MGC138491
  • MGC141938
  • nicein (100kDa)
  • Nicein subunit gamma
  • nicein-100kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
7954-GM/CF
Species: Hu
7954-GM/CF
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB414
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB414
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
6507-IL/CF
Species: Hu
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC

Publications for LAMC2 Antibody (NBP2-42388) (0)

There are no publications for LAMC2 Antibody (NBP2-42388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAMC2 Antibody (NBP2-42388) (0)

There are no reviews for LAMC2 Antibody (NBP2-42388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAMC2 Antibody (NBP2-42388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LAMC2 Antibody (NBP2-42388)

Discover related pathways, diseases and genes to LAMC2 Antibody (NBP2-42388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAMC2 Antibody (NBP2-42388)

Discover more about diseases related to LAMC2 Antibody (NBP2-42388).
 

Pathways for LAMC2 Antibody (NBP2-42388)

View related products by pathway.

PTMs for LAMC2 Antibody (NBP2-42388)

Learn more about PTMs related to LAMC2 Antibody (NBP2-42388).

Blogs on LAMC2

There are no specific blogs for LAMC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAMC2 Antibody (CL2980) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMC2
Uniprot