Acidic Calponin Antibody - BSA Free

Immunohistochemistry-Paraffin: Acidic Calponin Antibody [NBP2-38643] - Analysis in human placenta and skeletal muscle tissues. Corresponding Acidic Calponin RNA-seq data are presented for the same tissues.

Western Blot: Acidic Calponin Antibody [NBP2-38643] - Analysis in human cell lines U2OS and MCF-7 using Anti-CNN3 antibody. Corresponding CNN3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunocytochemistry/Immunofluorescence: Acidic Calponin Antibody [NBP2-38643] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.

Immunohistochemistry-Paraffin: Acidic Calponin Antibody [NBP2-38643] - Staining of human testis shows weak to moderate positivity in peritubuler myoid cells.

Immunohistochemistry-Paraffin: Acidic Calponin Antibody [NBP2-38643] - Staining of human kidney shows weak to moderate membranous and cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Acidic Calponin Antibody [NBP2-38643] - Staining of human placenta shows strong positivity in endothelial cells.

Immunohistochemistry-Paraffin: Acidic Calponin Antibody [NBP2-38643] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunoprecipitation: Acidic Calponin Antibody [NBP2-38643] - HAP1 lysates were prepared, and immunoprecipitation was performed using 2.0 μg of Acidic Calponin Antibody (NBP2-38643) pre-coupled to Dynabeads protein A. Samples were washed and processed for Western Blot with Acidic Calponin Antibody. For Western Blot, Acidic Calponin Antibody was used at 1/1000. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate; HC=antibody heavy chain. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Acidic Calponin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Acidic Calponin Antibody - BSA Free (NBP2-38643) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Acidic Calponin Protein (NBP2-38643PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Acidic Calponin Antibody - BSA Free

• calponin 3, acidic
• Calponin, acidic isoform
• calponin-3
• dJ639P13.2.2 (acidic calponin 3)

Background

Acidic Calponin, or CNN3 for short, consists of a 329 amino acid isoform that is 36 kDa, and is involved in the regulation of smooth muscle contraction. Current research is being conducted on the relationship between acidic calponin and several diseases and disorders, including aortic aneurysm and neuronitis. The protein is not associated with any pathways, but it does interact with the proteins FYN, SLX4, ATG5, LCP1, and EMD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNN3
• Uniprot:
  • Q15417(Human)