Immunocytochemistry/ Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center, cytosol & actin filaments. ...read more
Orthogonal Strategies: Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Novus Biologicals Rabbit Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free (NBP2-55439) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-Acetyl-CoA Carboxylase alpha/ACACA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACACA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free
ACACA
ACACacetyl-CoA carboxylase 1
ACC1
ACC1ACC
ACCA
ACC-alpha
AcetylCoA Carboxylase alpha
Acetyl-CoA Carboxylase alpha
acetyl-Coenzyme A carboxylase alpha
EC 6.4.1.2
Background
Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439) (0)
There are no reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free and receive a gift card or discount.