Acetyl-CoA Carboxylase alpha/ACACA Antibody

Images

 
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-55439] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center, cytosol & actin filaments. ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Acetyl-CoA Carboxylase alpha/ACACA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Specificity
Specificity of human Acetyl-CoA Carboxylase alpha/ACACA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACACA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Acetyl-CoA Carboxylase alpha/ACACA Recombinant Protein Antigen (NBP2-55439PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Acetyl-CoA Carboxylase alpha/ACACA Antibody

  • ACACA
  • ACACacetyl-CoA carboxylase 1
  • ACC1
  • ACC1ACC
  • ACCA
  • ACC-alpha
  • AcetylCoA Carboxylase alpha
  • Acetyl-CoA Carboxylase alpha
  • acetyl-Coenzyme A carboxylase alpha
  • EC 6.4.1.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC-Fr, KO
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-01833
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF7550
Species: Hu
Applications: WB, KO
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-90276
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55439
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439) (0)

There are no publications for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439) (0)

There are no reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Bioinformatics Tool for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439)

Discover related pathways, diseases and genes to Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439)

Discover more about diseases related to Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439).
 

Pathways for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439)

View related products by pathway.

PTMs for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439)

Learn more about PTMs related to Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439).
 

Research Areas for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP2-55439)

Find related products by research area.

Blogs on Acetyl-CoA Carboxylase alpha/ACACA

There are no specific blogs for Acetyl-CoA Carboxylase alpha/ACACA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl-CoA Carboxylase alpha/ACACA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACACA