Acetyl CoA synthetase Antibody

Images

 
Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/ Immunofluorescence: Acetyl CoA synthetase Antibody [NBP1-90276] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Acetyl CoA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Acetyl CoA synthetase Protein (NBP1-90276PEP)
Publications
Read Publications using
NBP1-90276 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20232292)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acetyl CoA synthetase Antibody

  • ACAS2
  • AceCS
  • acetate thiokinase
  • acetate-CoA ligase
  • Acetate--CoA ligase
  • Acetyl-CoA synthetase
  • acetyl-Coenzyme A synthetase 2 (ADP forming)
  • acetyl-coenzyme A synthetase, cytoplasmic
  • ACSA
  • ACSACECS
  • Acyl-activating enzyme
  • acyl-CoA synthetase short-chain family member 2EC 6.2.1.1
  • cytoplasmic acetyl-coenzyme A synthetase
  • dJ1161H23.1
  • DKFZp762G026
  • EC 6.2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90276
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Acetyl CoA synthetase Antibody (NBP1-90276)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Acetyl CoA synthetase Antibody (NBP1-90276) (0)

There are no reviews for Acetyl CoA synthetase Antibody (NBP1-90276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Acetyl CoA synthetase Antibody (NBP1-90276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl CoA synthetase Products

Bioinformatics Tool for Acetyl CoA synthetase Antibody (NBP1-90276)

Discover related pathways, diseases and genes to Acetyl CoA synthetase Antibody (NBP1-90276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl CoA synthetase Antibody (NBP1-90276)

Discover more about diseases related to Acetyl CoA synthetase Antibody (NBP1-90276).
 

Pathways for Acetyl CoA synthetase Antibody (NBP1-90276)

View related products by pathway.

Blogs on Acetyl CoA synthetase

There are no specific blogs for Acetyl CoA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl CoA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSS2
Entrez
Uniprot