Home » Acetyl Coenzyme A Carboxylase Beta » Acetyl Coenzyme A Carboxylase Beta Antibodies » Acetyl Coenzyme A Carboxylase Beta Antibody

Acetyl Coenzyme A Carboxylase Beta Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. ...read more
Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue .
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human testis shows strong positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Acetyl Coenzyme A Carboxylase Beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACACB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Acetyl Coenzyme A Carboxylase Beta Protein (NBP1-90274PEP)
Publications
Read Publication using NBP1-90274.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23460794)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acetyl Coenzyme A Carboxylase Beta Antibody

  • ACC2ACC-beta
  • ACCBacetyl-CoA carboxylase 2
  • acetyl-CoA carboxylase beta
  • acetyl-Coenzyme A carboxylase beta
  • EC 6.4.1.2
  • HACC275

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Acetyl-CoA
Carboxylase alpha/ACA ...
NBP3-15744
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Western blot analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY licence.
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Analysis of Fatty Acid Synthase, using NB400-114. Samples: 50 ug of total mouse liver lysate.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(24 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - An intracellular stain was performed on RH-30 cells with AMPK alpha 1 Antibody (2B7) NBP2-22127PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - An intracellular stain was performed on NIH3T3 cells with AMPK alpha 1 Antibody (2B7) NBP2-22127 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
ELISA: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng).
(11 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Hepatic SREBP1c and SREBP2 protein abundance in C57BL/6 mice assigned to a high-fat (HF) or a high-fat/exercise (HF + EX) group for 8 weeks. Cytosolic and nuclear SREBP1c abundance. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/jl/2013/908048/), licensed under a CC-BY licence.
Knockout Validated: SREBP1 Antibody (2A4) [NB600-582] - KO and OE of SREBP1 influenced lipid metabolism in Bel-7402 cells. The protein level of lipid-associated genes in SREBP1-KO, SREBP1-OE, and WT Bel-7402 cells. Data were expressed as mean -/+ standard error of the mean. *P < 0.05, **P < 0.01, and ***P < 0.001 vs. WT group, respectively.
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(46 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Fas/TNFRSF6/CD95
[HRP]
DFS00
(1 Review)
(17 Publications)
Species: Hu
Applications: ELISA
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(12 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
DGAT1 Antibody -
BSA Free
NB110-41487
Immunocytochemistry/Immunofluorescence: DGAT1 Antibody [NB110-41487] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-DGAT1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: DGAT1 Antibody [NB110-41487] - Factors regulating lipid storage and breakdown in C2C12 muscle cells.Muscle cells were incubated with PALM (open), NORM (filled), or HSFA (hatched). Pictured is protein abundance of DGAT1. In the figure panel, the data is expressed relative to a no fatty acid control condition (0mM). In panel B, #P<0.05 for a main effect of HSFA vs. PALM and NORM. Representative blot shown inset above the figure panel. DGAT = diacylglycerol acyltransferase; AU = arbitrary units. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120871), licensed under a CC-BY licence.
Western Blot: DGAT1 Antibody [NB110-41487] - Detection of DGAT1 in HepG2 lysate.
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
MCCC2 Antibody
NBP2-38403
Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38403] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining in human kidney and skeletal muscle tissues using anti-MCCC2 antibody. Corresponding MCCC2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PGC1 alpha
Antibody - BSA Free
NBP1-04676
Flow (Intracellular): PGC1 alpha Antibody [NBP1-04676] - An intracellular stain was performed on HeLa cells with NBP1-04676AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow (Intracellular): PGC1 alpha Antibody [NBP1-04676] - An intracellular stain was performed on HepG2 cells with PGC1 alpha Antibody and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Immunocytochemistry/Immunofluorescence: PGC1 alpha Antibody [NBP1-04676] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with PGC1 alpha Antibody [NBP1-04676] at a 1:200 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) [NB100-690] was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(11 Reviews)
(198 Publications)
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
SCD-1 Antibody
[Unconjugated]
AF7550
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and SK‑Mel‑28 human malignant melanoma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human SCD‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7550) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SCD‑1 at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and SCD-1 knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human SCD‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7550) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SCD‑1 at approximately 41 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: KO, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
CPT1A Antibody
NB100-53791
Western Blot: CPT1A Antibody [NB100-53791] - Staining of MCF7 cell lysate (35 ug protein in RIPA buffer). Antibody at 2 ug/mL. Detected by chemiluminescence.
(8 Publications)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
UCP2 Antibody
NB100-59742
Immunocytochemistry/Immunofluorescence: UCP2 Antibody [NB100-59742] - Analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing Mitochondrial staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Western Blot: UCP2 Antibody [NB100-59742] - Staining of rat adipose (A) and mouse spleen (B) lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence. Approx 37 kDa band observed in rat adipose and 28-30 kDa in mouse spleen lysates (calculated MW of 33.4kDa according to Mouse NP_035801.3 and 33.4kDa according to Rat NP_062227.2).
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, PEP-ELISA, WB
GPR3 Antibody
(3B4-G3)
H00002827-M01
Western Blot: GPR3 Antibody (3B4-G3) [H00002827-M01] - Analysis of GPR3 expression in transfected 293T cell line by GPR3 monoclonal antibody (M01), clone 3B4-G3.Lane 1: GPR3 transfected lysate(35 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: GPR3 Antibody (3B4-G3) [H00002827-M01] - Analysis of monoclonal antibody to GPR3 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. Antibody concentration 1 ug/ml.
Western Blot: GPR3 Antibody (3B4-G3) [H00002827-M01] - Analysis of GPR3 over-expressed 293 cell line, cotransfected with GPR3 Validated Chimera RNAi ( Cat # H00002827-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GPR3 monoclonal antibody (M01), clone 3B4-G3 (Cat # H00002827-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Acetyl Coenzyme A
Carboxylase Beta Anti ...
NBP1-90274
Acetyl Coenzyme A Carboxylase Beta Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl Coenzyme A Carboxylase Beta Products

Bioinformatics Tool for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover related pathways, diseases and genes to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover more about diseases related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).
 

Pathways for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

View related products by pathway.

PTMs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Learn more about PTMs related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).
 

Research Areas for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Find related products by research area.

Blogs on Acetyl Coenzyme A Carboxylase Beta

There are no specific blogs for Acetyl Coenzyme A Carboxylase Beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl Coenzyme A Carboxylase Beta Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ACACB
Entrez
Uniprot