![Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Immunohistochemistry-Paraffin-NBP1-90274-img0017.jpg "Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACACB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP3-15744-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-15744-img0002.jpg)
-Western-Blot-NBP3-15744-img0003.jpg)
-Flow-Cytometry-NBP2-22127-img0007.jpg)
-Flow-Cytometry-NBP2-22127-img0008.jpg)
-ELISA-NBP2-22127-img0001.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
-Western-Blot-NB600-582-img0004.jpg)
-Knockout-Validated-NB600-582-img0005.jpg)
-Simple-Western-NB600-582-img0003.jpg)
-Flow-Cytometry-NB300-537-img0007.jpg)
-Western-Blot-NB300-537-img0006.jpg)
-Flow-Cytometry-NB300-537-img0008.jpg)
-NBP1-49533-img0013.jpg)
-Western-Blot-H00002827-M01-img0011.jpg)
-Immunohistochemistry-Paraffin-H00002827-M01-img0007.jpg)
-Western-Blot-H00002827-M01-img0008.jpg)
| Publication using NBP1-90274 | Applications | Species |
|---|---|---|
| Ma L, Murea M, Snipes JA et al. An ACACB Variant Implicated in Diabetic Nephropathy Associates with Body Mass Index and Gene Expression in Obese Subjects. PLoS One 2013-01-01 [PMID: 23460794] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Diseases for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)Discover more about diseases related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).
| Pathways for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue .](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Western-Blot-NBP1-90274-img0007.jpg "Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue .")
![Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Immunohistochemistry-Paraffin-NBP1-90274-img0013.jpg "Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.")
![Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Immunohistochemistry-Paraffin-NBP1-90274-img0014.jpg "Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Immunohistochemistry-Paraffin-NBP1-90274-img0015.jpg "Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human testis shows strong positivity in spermatids.](http://images.novusbio.com/fullsize2/Acetyl-Coenzyme-A-Carboxylase-Beta-Antibody-Immunohistochemistry-Paraffin-NBP1-90274-img0016.jpg "Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human testis shows strong positivity in spermatids.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")