Acetyl Coenzyme A Carboxylase Beta Antibody - BSA Free

Analysis in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.

Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human testis shows strong positivity in spermatids.

Analysis in human adipose tissue tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Acetyl Coenzyme A Carboxylase Beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Acetyl Coenzyme A Carboxylase Beta Antibody - BSA Free (NBP1-90274) is a polyclonal antibody validated for use in IHC and WB. Anti-Acetyl Coenzyme A Carboxylase Beta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACACB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Acetyl Coenzyme A Carboxylase Beta Protein (NBP1-90274PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23460794)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Acetyl Coenzyme A Carboxylase Beta Antibody - BSA Free

• ACC2ACC-beta
• ACCBacetyl-CoA carboxylase 2
• acetyl-CoA carboxylase beta
• acetyl-Coenzyme A carboxylase beta
• EC 6.4.1.2
• HACC275

Background

"Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)(1)

Publication using NBP1-90274

• Ma L, Murea M, Snipes JA et al. An ACACB Variant Implicated in Diabetic Nephropathy Associates with Body Mass Index and Gene Expression in Obese Subjects. PLoS One 2013-01-01 [PMID: 23460794] (WB)

Bioinformatics

• Gene Symbol: ACACB
• Entrez:
  • 32(Human)
• Uniprot:
  • O00763(Human)