Home » Acetyl Coenzyme A Carboxylase Beta » Acetyl Coenzyme A Carboxylase Beta Antibodies » Acetyl Coenzyme A Carboxylase Beta Antibody

Acetyl Coenzyme A Carboxylase Beta Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue.
Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using anti-ACACB antibody. ...read more
Immunohistochemistry: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows high expression.
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Acetyl Coenzyme A Carboxylase Beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
Specificity
Specificity of human Acetyl Coenzyme A Carboxylase Beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACACB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-90274.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23460794)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acetyl Coenzyme A Carboxylase Beta Antibody

  • ACC2ACC-beta
  • ACCBacetyl-CoA carboxylase 2
  • acetyl-CoA carboxylase beta
  • acetyl-Coenzyme A carboxylase beta
  • EC 6.4.1.2
  • HACC275

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western blot shows lysates of A431 human epithelial carcinoma cell line, HCT‑116 human colorectal carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse Acetyl-CoA Carboxylase alpha /ACACA Monoclonal Antibody (Catalog # MAB6898) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Acetyl-CoA Carboxylase alpha /ACACA at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(21 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AMPK alpha 1
Antibody (2B7)
NBP2-22127
Western Blot: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Western blot analysis using AMPK alpha 1 mouse mAb against Jurkat (1), Hela (2), HepG2 (3), MCF-7 (4), Cos7 (5), NIH/3T3 (6), K562 (7), HEK293 (8), and PC-12 (9) cell lysate.
Immunocytochemistry/Immunofluorescence: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunofluorescence analysis of NTERA-2 cells using AMPK alpha 1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunohistochemical analysis of paraffin-embedded ovarian cancer (left) and brain tissues (right) using AMPK alpha 1 mouse mAb with DAB staining.
(5 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
SREBP1 Antibody
(2A4)
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(30 Publications)
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Hek293 cells with PPAR alpha/NR1C1 [3B6/PPAR] Antibody NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
DGAT1 Antibody
NB110-41487
Western Blot: DGAT1 Antibody [NB110-41487] - Detection of DGAT1 in HepG2 lysate.
Immunocytochemistry/Immunofluorescence: DGAT1 Antibody [NB110-41487] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-DGAT1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(1 Review)
(10 Publications)
Species: Hu, Mu
Applications: WB, IB, ICC/IF
MCCC2 Antibody
NBP2-38930
Western Blot: MCCC2 Antibody [NBP2-38930] - Analysis using Anti-MCCC2 antibody NBP2-38930 (A) shows similar pattern to independent antibody NBP1-82794 (B).
Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38930] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38930] - Staining of human skin.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
LKB1/STK11 Antibody
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PGC1 alpha Antibody
NBP1-04676
Western Blot: PGC1 alpha Antibody [NBP1-04676] - Total protein from human adipose and skeletal muscle tissue, HeLa and A431 cells lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-PGC1-alpha in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence
Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - Analysis of PGC-1 alpha in mouse prostate using DAB with hematoxylin counterstain.
Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - Analysis of a FFPE section of mouse prostate using rabbit polyclonal PGC1 alpha antibody at 1:200 dilution. The antibody generated an expected strong nuclear (punctate in some cells) and a weak cytoplasmic staining in the glandular cells lining of tubule-alveolar gland.
(11 Reviews)
(81 Publications)
Species: Hu, Mu, Rt, Po, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
SCD-1 Antibody
NBP1-26393
Western Blot: SCD Antibody [NBP1-26393] - Normal human liver.
Immunocytochemistry/Immunofluorescence: SCD Antibody [NBP1-26393] - SCD staining in Hela cells detected with a Dylight 488 labeled secondary antibody (Green) with Hoechst 33258 nuclear counterstain (Blue).
Species: Hu
Applications: WB, ICC/IF
Glut4 Antibody
NBP1-49533
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Glut4 Antibody [NBP1-49533] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-GLUT4 [NBP1-49533] at a 1:200 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: Glut4 Antibody [NBP1-49533] - Analysis of GLUT4 in mouse kidney
(4 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
CPT1A Antibody
NB100-53791
Western Blot: CPT1A Antibody [NB100-53791] - Staining of MCF7 cell lysate (35 ug protein in RIPA buffer). Antibody at 2 ug/mL. Detected by chemiluminescence.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
UCP2 Antibody
NB100-59742
Western Blot: UCP2 Antibody [NB100-59742] - Staining of rat adipose (A) and mouse spleen (B) lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence. Approx 37 kDa band observed in rat adipose and 28-30 kDa in mouse spleen lysates (calculated MW of 33.4kDa according to Mouse NP_035801.3 and 33.4kDa according to Rat NP_062227.2).
Immunocytochemistry/Immunofluorescence: UCP2 Antibody [NB100-59742] - Analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing Mitochondrial staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, PEP-ELISA
GPR3 Antibody
NBP2-41102
Western Blot: GPR3 Antibody [NBP2-41102] - Analysis of GPR3 in EL4 cell lysate with GPR3 antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: GPR3 Antibody [NBP2-41102] - Human spleen tissue with GPR3 antibody at 2.5 ug/mL.
Immunofluorescence: GPR3 Antibody [NBP2-41102] - Human Spleen cells with GPR3 antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl Coenzyme A Carboxylase Beta Products

Bioinformatics Tool for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover related pathways, diseases and genes to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover more about diseases related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).
 

Pathways for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

View related products by pathway.

PTMs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Learn more about PTMs related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).

Blogs on Acetyl Coenzyme A Carboxylase Beta

There are no specific blogs for Acetyl Coenzyme A Carboxylase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl Coenzyme A Carboxylase Beta Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ACACB
Entrez
Uniprot