Acetyl Coenzyme A Carboxylase Beta Antibody

Images

 
Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using anti-ACACB antibody. ...read more
Immunohistochemistry: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows high expression.
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Acetyl Coenzyme A Carboxylase Beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS
Specificity
Specificity of human Acetyl Coenzyme A Carboxylase Beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACACB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Acetyl Coenzyme A Carboxylase Beta Protein (NBP1-90274PEP)
Publications
Read Publication using NBP1-90274.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23460794)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acetyl Coenzyme A Carboxylase Beta Antibody

  • ACC2ACC-beta
  • ACCBacetyl-CoA carboxylase 2
  • acetyl-CoA carboxylase beta
  • acetyl-Coenzyme A carboxylase beta
  • EC 6.4.1.2
  • HACC275

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP2-38930
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-41102
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no reviews for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover related pathways, diseases and genes to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Discover more about diseases related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).
 

Pathways for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

View related products by pathway.

PTMs for Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274)

Learn more about PTMs related to Acetyl Coenzyme A Carboxylase Beta Antibody (NBP1-90274).

Blogs on Acetyl Coenzyme A Carboxylase Beta

There are no specific blogs for Acetyl Coenzyme A Carboxylase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl Coenzyme A Carboxylase Beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACACB
Entrez
Uniprot