Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

Images

 
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of Mouse heart, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary ...read more
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform ...read more
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary ...read more
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform ...read more
Immunoprecipitation: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of 300ug extracts of HepG2 cells using 3ug Acetyl-CoA Carboxylase alpha/ACACA antibody (NBP3-15744). Western blot was ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IP
Clone
5J4W7
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ACACA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

  • ACACA
  • ACACacetyl-CoA carboxylase 1
  • ACC1
  • ACC1ACC
  • ACCA
  • ACC-alpha
  • AcetylCoA Carboxylase alpha
  • Acetyl-CoA Carboxylase alpha
  • acetyl-Coenzyme A carboxylase alpha
  • EC 6.4.1.2

Background

Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90274
Species: Hu
Applications: IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF7550
Species: Hu
Applications: KO, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
DLP00
Species: Hu
Applications: ELISA
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15744
Species: Hu, Mu, Rt
Applications: WB, IHC, IP

Publications for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744) (0)

There are no publications for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744) (0)

There are no reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Diseases for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744)

Discover more about diseases related to Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744).
 

Pathways for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744)

View related products by pathway.

PTMs for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744)

Learn more about PTMs related to Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744).
 

Research Areas for Acetyl-CoA Carboxylase alpha/ACACA Antibody (NBP3-15744)

Find related products by research area.

Blogs on Acetyl-CoA Carboxylase alpha/ACACA

There are no specific blogs for Acetyl-CoA Carboxylase alpha/ACACA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACACA