ACE-2 Antibody

Images

 
Western Blot: ACE-2 Antibody [NBP1-88123] - Analysis in human kidney tissue.
Immunohistochemistry: ACE-2 Antibody [NBP1-88123] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACE-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACE-2 Protein (NBP1-88123PEP)
Publications
Read Publications using NBP1-88123.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20398667)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACE-2 Antibody

  • ACE2
  • ACE-2
  • ACEH
  • ACEHangiotensin I converting enzyme 2
  • ACE-related carboxypeptidase
  • angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
  • angiotensin-converting enzyme 2
  • Angiotensin-converting enzyme homolog
  • DKFZp434A014
  • EC 3.4.17
  • EC 3.4.17.23
  • Metalloprotease MPROT15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4965
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for ACE-2 Antibody (NBP1-88123)(2)

Reviews for ACE-2 Antibody (NBP1-88123) (0)

There are no reviews for ACE-2 Antibody (NBP1-88123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACE-2 Antibody (NBP1-88123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACE-2 Products

Bioinformatics Tool for ACE-2 Antibody (NBP1-88123)

Discover related pathways, diseases and genes to ACE-2 Antibody (NBP1-88123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACE-2 Antibody (NBP1-88123)

Discover more about diseases related to ACE-2 Antibody (NBP1-88123).
 

Pathways for ACE-2 Antibody (NBP1-88123)

View related products by pathway.

PTMs for ACE-2 Antibody (NBP1-88123)

Learn more about PTMs related to ACE-2 Antibody (NBP1-88123).
 

Research Areas for ACE-2 Antibody (NBP1-88123)

Find related products by research area.

Blogs on ACE-2

There are no specific blogs for ACE-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACE-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACE2
Entrez