Acetyl-coenzyme A transporter 1 Antibody (3A4)


Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in PC-12 (Cat # L012V1).
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi or non-transfected control. more
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected more
ELISA: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA

Order Details

Acetyl-coenzyme A transporter 1 Antibody (3A4) Summary

SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
SLC33A1 (3A4)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. It has also been used for ELISA and RNAi validation.
Read Publications using H00009197-M07.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Acetyl-coenzyme A transporter 1 Antibody (3A4)

  • ACATNAcetyl-CoA transporter 1
  • acetyl-Coenzyme A transporter
  • AT-1acetyl-coenzyme A transporter 1
  • AT1SPG42
  • solute carrier family 33 (acetyl-CoA transporter), member 1
  • Solute carrier family 33 member 1
  • spastic paraplegia 42 (autosomal dominant)


The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC

Publications for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07)(2)

Reviews for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07) (0)

There are no reviews for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Acetyl-coenzyme A transporter 1 Products

Bioinformatics Tool for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07)

Discover related pathways, diseases and genes to Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07)

Discover more about diseases related to Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07).

Pathways for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07)

View related products by pathway.

PTMs for Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07)

Learn more about PTMs related to Acetyl-coenzyme A transporter 1 Antibody (H00009197-M07).

Blogs on Acetyl-coenzyme A transporter 1

There are no specific blogs for Acetyl-coenzyme A transporter 1, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Acetyl-coenzyme A transporter 1 Antibody (3A4) and receive a gift card or discount.


Gene Symbol SLC33A1