17 beta-HSD1/HSD17B1 Antibody - BSA Free

Western Blot: 17 beta-HSD1/HSD17B1 Antibody [NBP1-56295] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP1-56295] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

17 beta-HSD1/HSD17B1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 31614207).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

• 17 betaHSD1
• 17 beta-HSD1
• 17-beta-HSD 1
• 17-beta-hydroxysteroid dehydrogenase type 1
• 20 alpha-hydroxysteroid dehydrogenase
• 20-alpha-HSD
• E17KSR
• E2DH
• EC 1.1.1.62
• EDH17B1
• EDH17B2
• EDH17B2EDHB17
• EDHB17
• estradiol 17-beta-dehydrogenase 1
• estradiol 17-beta-dehydrogenase-1
• HSD17
• HSD17B1
• hydroxysteroid (17-beta) dehydrogenase 1 isoform
• hydroxysteroid (17-beta) dehydrogenase 1
• MGC138140
• Placental 17-beta-hydroxysteroid dehydrogenase
• SDR28C1
• short chain dehydrogenase/reductase family 28CE, member 1

Background

HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)(2)

Publications using NBP1-56295

• Yazawa T, Imamichi Y, Uwada J et al. Evaluation of 17 beta-hydroxysteroid Dehydrogenase Activity using Androgen Receptor-mediated Transactivation J. Steroid Biochem. Mol. Biol. 2019-10-12 [PMID: 31614207] (WB, Human)
• Karman B, Basavarajappa M, Hannon P et al. Dioxin exposure reduces the steroidogenic capacity of mouse antral follicles mainly at the level of HSD17B1 without altering atresia Toxicology and Applied Pharmacology 2012-08-06 [PMID: 22889882] (WB, Mouse)

Bioinformatics

• Gene Symbol: HSD17B1
• Entrez:
  • 3292(Human)
• Uniprot:
  • P14061(Human)