17 beta-HSD1/HSD17B1 Antibody

Images

 
Western Blot: 17 beta-HSD1/HSD17B1 Antibody [NBP1-56295] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP1-56295] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

17 beta-HSD1/HSD17B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-56295 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for 17 beta-HSD1/HSD17B1 Antibody

  • 17 betaHSD1
  • 17 beta-HSD1
  • 17-beta-HSD 1
  • 17-beta-hydroxysteroid dehydrogenase type 1
  • 20 alpha-hydroxysteroid dehydrogenase
  • 20-alpha-HSD
  • E17KSR
  • E2DH
  • EC 1.1.1.62
  • EDH17B1
  • EDH17B2
  • EDH17B2EDHB17
  • EDHB17
  • estradiol 17-beta-dehydrogenase 1
  • estradiol 17-beta-dehydrogenase-1
  • HSD17
  • HSD17B1
  • hydroxysteroid (17-beta) dehydrogenase 1 isoform
  • hydroxysteroid (17-beta) dehydrogenase 1
  • MGC138140
  • Placental 17-beta-hydroxysteroid dehydrogenase
  • SDR28C1
  • short chain dehydrogenase/reductase family 28CE, member 1

Background

HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295) (0)

There are no reviews for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 17 beta-HSD1/HSD17B1 Products

Bioinformatics Tool for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)

Discover related pathways, diseases and genes to 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)

Discover more about diseases related to 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295).
 

Pathways for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)

View related products by pathway.

PTMs for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)

Learn more about PTMs related to 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295).
 

Research Areas for 17 beta-HSD1/HSD17B1 Antibody (NBP1-56295)

Find related products by research area.

Blogs on 17 beta-HSD1/HSD17B1

There are no specific blogs for 17 beta-HSD1/HSD17B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 17 beta-HSD1/HSD17B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B1
Entrez
Uniprot