HSD17B2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Analysis in human duodenum and testis tissues. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.

Western Blot: HSD17B2 Antibody [NBP1-92011] - Analysis in control (vector only transfected HEK293T lysate) and HSD17B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: HSD17B2 Antibody [NBP1-92011] - Staining of human cell line RT4 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human urinary bladder shows moderate to strong cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Analysis in control (vector only transfected HEK293T lysate) and HSD17B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Analysis in human duodenum and testis tissues using NBP1-92011 antibody. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD17B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD17B2 Antibody - BSA Free (NBP1-92011) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-HSD17B2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: antibody dilution of 20X
• Control Peptide:

  HSD17B2 Protein (NBP1-92011PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HSD17B2 Antibody - BSA Free

• 17-beta-hydroxysteroid dehydrogenase type 2
• 20 alpha-hydroxysteroid dehydrogenase
• E2DH
• EC 1.1.1.62,17-beta-HSD 2
• EC 1.1.1.63
• EDH17B220-alpha-HSD
• estradiol 17-beta-dehydrogenase 2
• HSD17
• hydroxysteroid (17-beta) dehydrogenase 2
• Microsomal 17-beta-hydroxysteroid dehydrogenase
• SDR9C2
• short chain dehydrogenase/reductase family 9C, member 2
• Testosterone 17-beta-dehydrogenase

Background

Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol andestrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSD17B2 Antibody (NBP1-92011)(1)

Publication using NBP1-92011

• Lee YE, He HL, Shiue YL et al. The prognostic impact of lipid biosynthesis-associated markers, HSD17B2 and HMGCS2, in rectal cancer treated with neoadjuvant concurrent chemoradiotherapy. Tumour Biol. 2015-05-01 [PMID: 25929810]

Bioinformatics

• Gene Symbol: HSD17B2
• Entrez:
  • 3294(Human)
• Uniprot:
  • P37059(Human)