HSD17B2 Antibody

Images

 
Western Blot: HSD17B2 Antibody [NBP1-92011] - Analysis in control (vector only transfected HEK293T lysate) and HSD17B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: HSD17B2 Antibody [NBP1-92011] - Staining of human cell line RT4 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Analysis in human duodenum and testis tissues. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human urinary bladder shows moderate to strong cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HSD17B2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL
Specificity
Specificity of human HSD17B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSD17B2 Protein (NBP1-92011PEP)
Publications
Read Publication using NBP1-92011.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B2 Antibody

  • 17-beta-hydroxysteroid dehydrogenase type 2
  • 20 alpha-hydroxysteroid dehydrogenase
  • E2DH
  • EC 1.1.1.62,17-beta-HSD 2
  • EC 1.1.1.63
  • EDH17B220-alpha-HSD
  • estradiol 17-beta-dehydrogenase 2
  • HSD17
  • hydroxysteroid (17-beta) dehydrogenase 2
  • Microsomal 17-beta-hydroxysteroid dehydrogenase
  • SDR9C2
  • short chain dehydrogenase/reductase family 9C, member 2
  • Testosterone 17-beta-dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003292-M03
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB200-305
Species: Hu, Mu, Pm, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSD17B2 Antibody (NBP1-92011)(1)

Reviews for HSD17B2 Antibody (NBP1-92011) (0)

There are no reviews for HSD17B2 Antibody (NBP1-92011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSD17B2 Antibody (NBP1-92011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSD17B2 Products

Bioinformatics Tool for HSD17B2 Antibody (NBP1-92011)

Discover related pathways, diseases and genes to HSD17B2 Antibody (NBP1-92011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B2 Antibody (NBP1-92011)

Discover more about diseases related to HSD17B2 Antibody (NBP1-92011).
 

Pathways for HSD17B2 Antibody (NBP1-92011)

View related products by pathway.

PTMs for HSD17B2 Antibody (NBP1-92011)

Learn more about PTMs related to HSD17B2 Antibody (NBP1-92011).

Blogs on HSD17B2

There are no specific blogs for HSD17B2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B2
Entrez
Uniprot