ZAG Antibody - BSA Free

Western Blot: ZAG Antibody [NBP1-59179] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: ZAG Antibody [NBP1-59179] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZAG Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AZGP1(alpha-2-glycoprotein 1, zinc-binding) The peptide sequence was selected from the N terminal of AZGP1. Peptide sequence MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AZGP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZAG Antibody - BSA Free

• alpha-2-glycoprotein 1, zinc
• alpha-2-glycoprotein 1, zinc-binding
• AZGP1
• ZA2G
• ZAG
• ZAGzn-alpha-2-GP
• zinc
• zinc-alpha-2-glycoprotein
• zn-alpha-2-glycoprotein
• ZNGP1

Background

Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AZGP1
• Uniprot:
  • P25311()