Genetic Strategies: Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed ...read more
Orthogonal Strategies: Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell lines Caco-2 and HeLa using anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell ...read more
Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Human lung epithelial A549 cells and primary bronchial epithelial cells (hAECB) lack FcgammaR (CD16, CD64, and CD32) and FcalphaR (CD89) cell surface expression as ...read more
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining in human placental Hoffbauer cells at a 1:65 dilution. Image from a verified customer review.
Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in control (vector only transfected HEK293T lysate) and FCGRT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under ...read more
Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).
FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) and (A) a basal cell marker, cytokeratin-14 (red), or (B) a goblet cell marker, ...read more
Immunocytochemistry/ Immunofluorescence: FCRN/FCGRT Antibody [NBP1-89128] - FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) & ...read more
Expression of FcRn in non-cancerous A. and cancerous B. serial lung sections from a small set of patients (n=8)(A) FcRn expression was very week in bronchial epithelial cells (left panel) and marked in alveolar ...read more
Expression of FcRn in non-cancerous A. and cancerous B. serial lung sections from a small set of patients (n=8)(A) FcRn expression was very week in bronchial epithelial cells (left panel) and marked in alveolar ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCGRT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunohistochemistry-Frozen Reported in scientific literature (PMID 24278022).
Immunohistochemistry-Paraffin 1:5000 - 1:10000
Knockout Validated
Simple Western 1:20
Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in h. Liver, HepG2 (middle) and THP-1, separated by Size, antibody dilution of 1:20, apparent MW was 51, 44 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue
Theoretical MW
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Cynomolgus Monkey reactivity reported in scientific literature (PMID: 31746560).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for FCRN/FCGRT Antibody - BSA Free
alpha-chain
Fc fragment of IgG, receptor, transporter, alpha
FCGRT
FcRn alpha chain
FCRN
FCRNimmunoglobulin receptor, intestinal, heavy chain
IgG Fc fragment receptor transporter alpha chain
IgG receptor FcRn large subunit p51
major histocompatibility complex class I-like Fc receptor
Neonatal Fc receptor
neonatal Fc-receptor for Ig
Background
The FCGRT gene encodes a 365 amino acid long, 39 kDA IgG receptor FcRn large subunit p51 protein that transfers immunoglobulin G antibodies across the placenta from mother to fetus, as well as functions to protect the antibody from degradation. FCGRT interacts with genes CA6, ELANE, AZGP1, B2M, and ALB. It has been linked to diseases such as: lupus, nephritis, leukemia, arthritis, immunodeficiency, epidermolysis bullosa acquisita, persistent fetal circulation syndrome, and pemphigus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for FCRN/FCGRT Antibody (NBP1-89128). (Showing 1 - 1 of 1 FAQs).
I use the anti-FcRn (Ref #NBP1-89128) and I was wondering if you have any clue about the nature of the higher slight band that we can see on the datasheet. Is it an isoform ?
The theoretical molecular weight of FCGRT is ~39.7kDa. We typically see this antibody run true to size, as although there is a signal peptide lost, there is a glycoslation site that will make up for the lost weight. In our image on our datasheet, lane 3 is the FCGRT protein co-expressed with a C- terminal myc-DDK tag, which is why we are seeing the faint signal ~3kDa above the protein of interest.
FcRn - neonatal Fc receptor encoded by the FCGRT gene Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.