FCRN/FCGRT Antibody

Images

 
Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.
Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under ...read more
Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCRN/FCGRT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCGRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24278022).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
FCRN/FCGRT Protein (NBP1-89128PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89128 in the following applications:

Publications
Read Publications using
NBP1-89128 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24260574)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCRN/FCGRT Antibody

  • alpha-chain
  • Fc fragment of IgG, receptor, transporter, alpha
  • FCGRT
  • FcRn alpha chain
  • FCRN
  • FCRNimmunoglobulin receptor, intestinal, heavy chain
  • IgG Fc fragment receptor transporter alpha chain
  • IgG receptor FcRn large subunit p51
  • major histocompatibility complex class I-like Fc receptor
  • Neonatal Fc receptor
  • neonatal Fc-receptor for Ig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
H00000712-P01
Species: Hu
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for FCRN/FCGRT Antibody (NBP1-89128)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 4 applications: IHC, IHC-Fr, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-Fr
(1)
IHC-P
(1)
WB
(5)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-89128 Applications Species
Zimmermann N, Thormann V, Hu B et al. Human isotype-dependent inhibitory antibody responses against Mycobacterium tuberculosis. EMBO Mol Med Nov 2 2016 [PMID: 27729388] (WB, Human) WB Human
Dalloneau E, Baroukh N, Mavridis K et al. Downregulation of the neonatal Fc receptor expression in non-small cell lung cancer tissue is associated with a poor prognosis. Oncotarget. Aug 23 2016 [PMID: 27384673] (WB, Human) WB Human
Morel A, Passot C, Arnoult C et al. The neonatal Fc receptor (FcRn) does not modulate hepatitis C virus neutralization J. Gen. Virol. 2015 Jan 22 [PMID: 25614590] (WB, Human) WB Human
Ko SY, Pegu A, Rudicell RS et al. Enhanced neonatal Fc receptor function improves protection against primate SHIV infection. Nature 2014 Oct 30 [PMID: 25119033]
Gupta S, Gach JS, Becerra JC et al. The Neonatal Fc Receptor (FcRn) Enhances Human Immunodeficiency Virus Type 1 (HIV-1) Transcytosis across Epithelial Cells. PLoS Pathog. 2013 Nov [PMID: 24311991] (WB, IHC-P, Human) WB, IHC-P Human
Baker K, Rath T, Flak MB et al. Neonatal Fc Receptor Expression in Dendritic Cells Mediates Protective Immunity Against Colorectal Cancer. Immunity 2013 Dec 12 [PMID: 24290911] (IHC, Human) IHC Human
Gupta S, Gach JS, Becerra JC et al. The Neonatal Fc receptor (FcRn) enhances human immunodeficiency virus type 1 (HIV-1) transcytosis across epithelial cells. PLoS Pathog 2013 Nov [PMID: 24278022] (WB, IHC-Fr, Human) WB, IHC-Fr Human
Seijsing J, Lindborg M, Lofblom J et al. Robust expression of the human neonatal Fc receptor in a truncated soluble form and as a full-length membrane-bound protein in fusion with eGFP. PLoS One 2013 [PMID: 24260574]

Review for FCRN/FCGRT Antibody (NBP1-89128) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP1-89128:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin FCRN/FCGRT NBP1-89128
Enlarge
reviewed by:
Corey.
IHC-P Human 12/04/2012
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedPenile urethra and placental tissue
SpeciesHuman
CommentsExcellent staining for both tissues. Image provided courtesy of Dr. Jeffery Pudney (Boston University School of Medicine, Boston MA)

Blocking

Blocking DetailsDako serum free 20mins RT

Primary Anitbody

Dilution Ratio1:65, 2hrs RT, Dako diluent

Secondary Antibody

Secondary DescriptionMACH 4 Universal AP Polymer kit
Secondary Manufacturer Cat#Biocare Medical, #M4U536

Details

Detection NotesFast red chromogen, develop 10-15 mins under microscope
Fixation Details10% unbuffered formaldehyde EM grade for 8 hrs at RT, Citrate buffer pH6 in a pressure cooker, 30 secs at 125C
Wash DescriptionTRIS buffer + 0.1% Tween20, Rinsing 5mins 2x

Comments

CommentsExcellent staining for both tissues. Image provided courtesy of Dr. Jeffery Pudney (Boston University School of Medicine, Boston MA)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRN/FCGRT Antibody (NBP1-89128). (Showing 1 - 1 of 1 FAQs).

  1. I use the anti-FcRn (Ref #NBP1-89128) and I was wondering if you have any clue about the nature of the higher slight band that we can see on the datasheet. Is it an isoform ?
    • The theoretical molecular weight of FCGRT is ~39.7kDa. We typically see this antibody run true to size, as although there is a signal peptide lost, there is a glycoslation site that will make up for the lost weight. In our image on our datasheet, lane 3 is the FCGRT protein co-expressed with a C- terminal myc-DDK tag, which is why we are seeing the faint signal ~3kDa above the protein of interest.

Secondary Antibodies

 

Isotype Controls

Additional FCRN/FCGRT Products

Bioinformatics Tool for FCRN/FCGRT Antibody (NBP1-89128)

Discover related pathways, diseases and genes to FCRN/FCGRT Antibody (NBP1-89128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRN/FCGRT Antibody (NBP1-89128)

Discover more about diseases related to FCRN/FCGRT Antibody (NBP1-89128).
 

Pathways for FCRN/FCGRT Antibody (NBP1-89128)

View related products by pathway.

Blogs on FCRN/FCGRT.

FcRn - neonatal Fc receptor encoded by the FCGRT gene
Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Corey.
12/04/2012
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol FCGRT
Entrez
Uniprot