BPNT1 Antibody (2E1)

Images

 
Western Blot: BPNT1 Antibody (2E1) [H00010380-M01] - BPNT1 monoclonal antibody (M01), clone 2E1 Analysis of BPNT1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: BPNT1 Antibody (2E1) [H00010380-M01] - Analysis of monoclonal antibody to BPNT1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: BPNT1 Antibody (2E1) [H00010380-M01] - Analysis of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Western Blot: BPNT1 Antibody (2E1) [H00010380-M01] - Analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody (M01), clone 2E1.Lane 1: BPNT1 transfected lysate(28.1 KDa).Lane 2: ...read more
Sandwich ELISA: BPNT1 Antibody (2E1) [H00010380-M01] - Detection limit for recombinant GST tagged BPNT1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BPNT1 Antibody (2E1) Summary

Immunogen
BPNT1 (NP_006076, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTC ATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQ ELIEDSQWEEILKQPC
Specificity
BPNT1 - 3'(2'), 5'-bisphosphate nucleotidase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BPNT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BPNT1 Antibody (2E1)

  • 3'(2'), 5'-bisphosphate nucleotidase 1,3'(2')5'-bisphosphate nucleotidase 1
  • Bisphosphate 3'-nucleotidase 1
  • BPntase
  • EC 3.1.3
  • EC 3.1.3.7
  • PAP-inositol-1,4-phosphatase
  • PIP

Background

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5535
Species: Hu
Applications: WB, Simple Western
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF5117
Species: Hu
Applications: WB, IHC
H00010380-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for BPNT1 Antibody (H00010380-M01) (0)

There are no publications for BPNT1 Antibody (H00010380-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPNT1 Antibody (H00010380-M01) (0)

There are no reviews for BPNT1 Antibody (H00010380-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BPNT1 Antibody (H00010380-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPNT1 Products

Bioinformatics Tool for BPNT1 Antibody (H00010380-M01)

Discover related pathways, diseases and genes to BPNT1 Antibody (H00010380-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPNT1 Antibody (H00010380-M01)

Discover more about diseases related to BPNT1 Antibody (H00010380-M01).
 

Pathways for BPNT1 Antibody (H00010380-M01)

View related products by pathway.

Research Areas for BPNT1 Antibody (H00010380-M01)

Find related products by research area.

Blogs on BPNT1

There are no specific blogs for BPNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPNT1 Antibody (2E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol BPNT1
Entrez
OMIM
Uniprot