XPF Antibody - BSA Free

Western Blot: XPF Antibody [NBP3-38510] - Western blot analysis of various lysates using XPF Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunoprecipitation: XPF Antibody [NBP3-38510] - Immunoprecipitation analysis of 150 ug extracts of 293T cells using 3 ug XPF antibody. Western blot was performed from the immunoprecipitate using XPF antibody at a dilution of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

XPF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit XPF Antibody - BSA Free (NBP3-38510) is a polyclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 513-782 of human XPF (NP_005227.1).
  
  Sequence:
  GKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERCC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for XPF Antibody - BSA Free

• DNA excision repair protein ERCC-4
• DNA repair protein complementing XP-F cells
• EC 3.1
• ERCC11
• ERCC4
• excision repair cross-complementing rodent repair deficiency, complementationgroup 4
• xeroderma pigmentosum, complementation group F
• XPF
• XPFcomplementing defective, in Chinese hamster

Background

XPF/ERCC4 is suggested to play a role in the repair of DNA double-strand breaks (DSB), homologous recombination, and gene conversion via single-strand annealing (SSA). XPF/ERCC4 is an endonuclease that incises 5-prime DNA. Defects in XPF/ERCC4 cause xeroderma pigmentosum VI (XP6) an autosomal recessive disease characterized by hypersensitivity to sunlight and a predisposition to skin cancer as well as neurological abnormalities. Defects in XPF/ERCC4 are also responsible for XFE progeroid syndrome, a syndrome characterized by dwarfism, cachexia, and microcephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERCC4