RAD52 Antibody

Western Blot: RAD52 Antibody [NBP2-58116] - HCC1937 human breast cancer cells untreated (1) and treated with a PARP inhibitor for 96 h (2). Two RAD52 bands can be appreciated at around 55 kDa. Ponceau red staining is used as total protein loading control (below). Primary antibody dilution 1:500 (overnight, 4C, rotation). Image from verified customer review.

Immunocytochemistry/Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RAD52 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAD52
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB, ICC/IF, KD reported in scientific publication (PMID: 32690953).
• Control Peptide:

  RAD52 Recombinant Protein Antigen (NBP2-58116PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAD52 Antibody

• DNA repair protein RAD52 homolog
• RAD52 (S. cerevisiae) homolog
• RAD52 homolog (S. cerevisiae)
• recombination protein RAD52
• rhabdomyosarcoma antigen MU-RMS-40.23

Background

DNA double-strand breaks are generated by ionizing radiation and endogenously produced radicals, and they often are repaired through the RAD52 homologous recombination pathway. The RAD52 family includes RAD51, RAD52, RAD54, RAD54B and MRE11 genes. Rad51 and Rad52 proteins perform the key steps in homologous recombination (HR), including the search for DNA homology and strand exchange, through similar mechanisms. Mre11 functions in both non-homologous end joining, and meiotic HR, and it is essential in mitosis for chromosome maintenance. Rad54 belongs to the SWI2/SNF2 subfamily of ATPases, which includes the DNA helicases involved in replication, recombination, and repair, as it contains seven amino acid sequence motifs that are largely conserved. Rad54 ATPase activity is dependent on double-stranded (ds) DNA, and the ATPase activity of Rad54 is not absolutely required for its DNA repair function, suggesting that these activities occur at distinct regions of the molecule. RAD54B is significantly homologous to the RAD54 recombination gene. Expression of RAD54B is highest in testis and spleen, which are active in both meiotic and mitotic recombination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAD52 Antibody (NBP2-58116)(1)

Publication using NBP2-58116

• Volcic M, Sparrer KMJ, Koepke L et al. Vpu modulates DNA repair to suppress innate sensing and hyper-integration of HIV-1 Nat Microbiol 2020-07-20 [PMID: 32690953] (ICC/IF, KD, WB, Human)

Review for RAD52 Antibody (NBP2-58116) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 05/31/2022

Summary

• Application: Western Blot
• Sample Tested: HCC1937 breast cancer cells
• Species: Human
• Lot: 000001614

Comments

• Comments: Primary antibody dilution 1:500 (overnight, 4ºC, rotation)

Bioinformatics

• Gene Symbol: RAD52