RAD52 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD52 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE
Specificity
Specificity of human RAD52 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD52
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB, ICC/IF, KD reported in scientific publication (PMID: 32690953).
Control Peptide
RAD52 Recombinant Protein Antigen (NBP2-58116PEP)
Publications
Read Publication using
NBP2-58116 in the following applications:

  • 1 publication
  • KD
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAD52 Antibody

  • DNA repair protein RAD52 homolog
  • RAD52 (S. cerevisiae) homolog
  • RAD52 homolog (S. cerevisiae)
  • recombination protein RAD52
  • rhabdomyosarcoma antigen MU-RMS-40.23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, In vitro, KD
NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
H00005810-M01J
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA, ELISA(Cap)
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-508
Species: Hu, Mu, Rt, Ha
Applications: WB, IP
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Single-Cell Western
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-404
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-33916
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-58233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO

Publications for RAD52 Antibody (NBP2-58116)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, KD, WB.


Filter By Application
ICC/IF
(1)
KD
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RAD52 Antibody (NBP2-58116) (0)

There are no reviews for RAD52 Antibody (NBP2-58116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAD52 Antibody (NBP2-58116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAD52 Products

Array NBP2-58116

Bioinformatics Tool for RAD52 Antibody (NBP2-58116)

Discover related pathways, diseases and genes to RAD52 Antibody (NBP2-58116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD52 Antibody (NBP2-58116)

Discover more about diseases related to RAD52 Antibody (NBP2-58116).
 

Pathways for RAD52 Antibody (NBP2-58116)

View related products by pathway.

PTMs for RAD52 Antibody (NBP2-58116)

Learn more about PTMs related to RAD52 Antibody (NBP2-58116).
 

Research Areas for RAD52 Antibody (NBP2-58116)

Find related products by research area.

Blogs on RAD52

There are no specific blogs for RAD52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD52