RAD52 Antibody

Images

 
Western Blot: RAD52 Antibody [NBP2-58116] - HCC1937 human breast cancer cells untreated (1) and treated with a PARP inhibitor for 96 h (2). Two RAD52 bands can be appreciated at around 55 kDa. Ponceau red staining is ...read more
Immunocytochemistry/ Immunofluorescence: RAD52 Antibody [NBP2-58116] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD52 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD52
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB, ICC/IF, KD reported in scientific publication (PMID: 32690953).
Control Peptide
RAD52 Recombinant Protein Antigen (NBP2-58116PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-58116 in the following applications:

Publications
Read Publication using
NBP2-58116 in the following applications:

  • 1 publication
  • KD
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAD52 Antibody

  • DNA repair protein RAD52 homolog
  • RAD52 (S. cerevisiae) homolog
  • RAD52 homolog (S. cerevisiae)
  • recombination protein RAD52
  • rhabdomyosarcoma antigen MU-RMS-40.23

Background

DNA double-strand breaks are generated by ionizing radiation and endogenously produced radicals, and they often are repaired through the RAD52 homologous recombination pathway. The RAD52 family includes RAD51, RAD52, RAD54, RAD54B and MRE11 genes. Rad51 and Rad52 proteins perform the key steps in homologous recombination (HR), including the search for DNA homology and strand exchange, through similar mechanisms. Mre11 functions in both non-homologous end joining, and meiotic HR, and it is essential in mitosis for chromosome maintenance. Rad54 belongs to the SWI2/SNF2 subfamily of ATPases, which includes the DNA helicases involved in replication, recombination, and repair, as it contains seven amino acid sequence motifs that are largely conserved. Rad54 ATPase activity is dependent on double-stranded (ds) DNA, and the ATPase activity of Rad54 is not absolutely required for its DNA repair function, suggesting that these activities occur at distinct regions of the molecule. RAD54B is significantly homologous to the RAD54 recombination gene. Expression of RAD54B is highest in testis and spleen, which are active in both meiotic and mitotic recombination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005810-M01J
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
AF1626
Species: Hu
Applications: ICC, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00056852-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-33916
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP1-58233
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB

Publications for RAD52 Antibody (NBP2-58116)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, KD, WB.


Filter By Application
ICC/IF
(1)
KD
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RAD52 Antibody (NBP2-58116) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-58116:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RAD52 NBP2-58116
Enlarge
4
reviewed by:
Marina Rodriguez Candela
WB Human 05/31/2022
View

Summary

ApplicationWestern Blot
Sample TestedHCC1937 breast cancer cells
SpeciesHuman
Lot000001614

Comments

CommentsPrimary antibody dilution 1:500 (overnight, 4ºC, rotation)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAD52 Antibody (NBP2-58116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAD52 Products

Array NBP2-58116

Bioinformatics Tool for RAD52 Antibody (NBP2-58116)

Discover related pathways, diseases and genes to RAD52 Antibody (NBP2-58116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD52 Antibody (NBP2-58116)

Discover more about diseases related to RAD52 Antibody (NBP2-58116).
 

Pathways for RAD52 Antibody (NBP2-58116)

View related products by pathway.

PTMs for RAD52 Antibody (NBP2-58116)

Learn more about PTMs related to RAD52 Antibody (NBP2-58116).
 

Research Areas for RAD52 Antibody (NBP2-58116)

Find related products by research area.

Blogs on RAD52

There are no specific blogs for RAD52, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Marina Rodriguez Candela
05/31/2022
Application: WB
Species: Human

Bioinformatics

Gene Symbol RAD52