XPF Antibody

Images

 
Western Blot: XPF Antibody [NBP2-58407] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: XPF Antibody [NBP2-58407] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XPF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK
Specificity
Specificity of human XPF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERCC4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XPF Recombinant Protein Antigen (NBP2-58407PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for XPF Antibody

  • DNA excision repair protein ERCC-4
  • DNA repair protein complementing XP-F cells
  • EC 3.1
  • ERCC11
  • ERCC4
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 4
  • xeroderma pigmentosum, complementation group F
  • XPF
  • XPFcomplementing defective, in Chinese hamster

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33589
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-58116
Species: Hu
Applications: WB, ICC/IF, PLA, KD
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-2064
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NB100-165
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP

Publications for XPF Antibody (NBP2-58407) (0)

There are no publications for XPF Antibody (NBP2-58407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPF Antibody (NBP2-58407) (0)

There are no reviews for XPF Antibody (NBP2-58407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XPF Antibody (NBP2-58407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional XPF Products

Bioinformatics Tool for XPF Antibody (NBP2-58407)

Discover related pathways, diseases and genes to XPF Antibody (NBP2-58407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPF Antibody (NBP2-58407)

Discover more about diseases related to XPF Antibody (NBP2-58407).
 

Pathways for XPF Antibody (NBP2-58407)

View related products by pathway.

PTMs for XPF Antibody (NBP2-58407)

Learn more about PTMs related to XPF Antibody (NBP2-58407).
 

Research Areas for XPF Antibody (NBP2-58407)

Find related products by research area.

Blogs on XPF.

NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC4