Von Hippel Lindau Antibody

Images

 
Western Blot: Von Hippel Lindau Antibody [H00007428-D01P] - Analysis of VHL expression in mouse lung.
Immunocytochemistry/ Immunofluorescence: Von Hippel Lindau Antibody [H00007428-D01P] - analysis of Von Hippel Lindau in ARPE-19 cells using anti-Von Hippel Lindau antibody. Image from verified customer review.
Western Blot: Von Hippel Lindau Antibody [H00007428-D01P] - Analysis of VHL expression in transfected 293T cell line by VHL polyclonal antibody.Lane 1: VHL transfected lysate(19.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Von Hippel Lindau Antibody Summary

Immunogen
VHL (ENSP00000344757, 1 a.a. - 172 a.a.) full-length human protein. MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VHL
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.
Reviewed Applications
Read 1 Review rated 5
using
H00007428-D01P in the following application:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Von Hippel Lindau Antibody

  • elongin binding protein
  • HRCA1
  • Protein G7
  • pVHL
  • RCA1
  • VHL1
  • von Hippel-Lindau disease tumor suppressor
  • von Hippel-Lindau syndrome
  • von Hippel-Lindau tumor suppressor

Background

Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP

Publications for Von Hippel Lindau Antibody (H00007428-D01P) (0)

There are no publications for Von Hippel Lindau Antibody (H00007428-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Von Hippel Lindau Antibody (H00007428-D01P) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using H00007428-D01P:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Von Hippel Lindau H00007428-D01P
Enlarge
reviewed by:
Helder Andre
IF Human 05/14/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedARPE-19 cells
SpeciesHuman

Blocking

Blocking Details10% goat serum in PBS-TritonX (0.1%) (30min @ RT)

Primary Anitbody

Dilution Ratio1:500 in blocking solution (1h @ RT)

Secondary Antibody

Secondary Description1:1000 Goat anti-rabbit IgG-A488 in blocking solution (1h @ RT)

Details

Detection NotesEpifluorescence microscope
Fixation DetailsFixed in 4% buffered formalin (15min @ RT); Permeabilized in PBS-TritonX (0.5%) (10min @ RT)
Wash Description3x5min PBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Von Hippel Lindau Antibody (H00007428-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Von Hippel Lindau Products

Bioinformatics Tool for Von Hippel Lindau Antibody (H00007428-D01P)

Discover related pathways, diseases and genes to Von Hippel Lindau Antibody (H00007428-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Von Hippel Lindau Antibody (H00007428-D01P)

Discover more about diseases related to Von Hippel Lindau Antibody (H00007428-D01P).
 

Pathways for Von Hippel Lindau Antibody (H00007428-D01P)

View related products by pathway.

PTMs for Von Hippel Lindau Antibody (H00007428-D01P)

Learn more about PTMs related to Von Hippel Lindau Antibody (H00007428-D01P).
 

Research Areas for Von Hippel Lindau Antibody (H00007428-D01P)

Find related products by research area.

Blogs on Von Hippel Lindau

There are no specific blogs for Von Hippel Lindau, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Helder Andre
05/14/2015
Application: IF
Species: Human

Bioinformatics

Gene Symbol VHL
Uniprot