SDHD Antibody

Images

 
Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372] - Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SDHD Antibody [NBP1-92372] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SDHD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
Specificity
Specificity of human SDHD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDHD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-92372.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SDHD Antibody

  • CBT1
  • CII-4
  • cybS
  • PGL
  • PGL1
  • QPs3
  • SDH4
  • succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  • Succinate dehydrogenase complex subunit D
  • succinate dehydrogenase complex, subunit D, integral membrane protein
  • succinate dehydrogenase ubiquinone cytochrome B small subunit
  • Succinate-ubiquinone oxidoreductase cytochrome b small subunit
  • Succinate-ubiquinone reductase membrane anchor subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NB100-485
Species: Hu
Applications: WB, IP, ChIP
AF482
Species: Mu
Applications: WB, IHC
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92259
Species: Hu
Applications: IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91305
Species: Hu
Applications: WB
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-793
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA, IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-82991
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92372
Species: Hu
Applications: IHC, IHC-P

Publications for SDHD Antibody (NBP1-92372)(1)

Reviews for SDHD Antibody (NBP1-92372) (0)

There are no reviews for SDHD Antibody (NBP1-92372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SDHD Antibody (NBP1-92372). (Showing 1 - 1 of 1 FAQ).

  1. I want to use SDHD antibody (NBP1-92372) to detect mouse IHC sample, can this antibody recognize mouse epitope?
    • NBP1-92372 has only been validated for use in human, hence we cannot guarantee the usage in mouse. If you are interested in trying this antibody in mouse you would qualify for our Innovators Reward Program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SDHD Products

Bioinformatics Tool for SDHD Antibody (NBP1-92372)

Discover related pathways, diseases and genes to SDHD Antibody (NBP1-92372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDHD Antibody (NBP1-92372)

Discover more about diseases related to SDHD Antibody (NBP1-92372).
 

Pathways for SDHD Antibody (NBP1-92372)

View related products by pathway.

PTMs for SDHD Antibody (NBP1-92372)

Learn more about PTMs related to SDHD Antibody (NBP1-92372).
 

Research Areas for SDHD Antibody (NBP1-92372)

Find related products by research area.

Blogs on SDHD.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDHD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHD
Entrez
Uniprot
COVID-19 update