TRIM50 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM50 Protein (NBP1-81988PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM50 Antibody

  • tripartite motif containing 50
  • tripartite motif protein 50
  • tripartite motif-containing 50A
  • tripartite motif-containing protein 50

Background

The TRIM50 gene codes a E3 ubiquitin-protein ligase TRIM50 protein that exists in two isoforms: isoform alpha is 487 amino acids long at 54 kDA while isoform beta is 486 amino acids long at 54 kDA. TRIM50 is associated with Williams-Beuren syndrome and interacts with genes UBE2D1, UBE2D2, UBE2D3, UBE2D4 and UBE2E1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM50 Antibody (NBP1-81988) (0)

There are no publications for TRIM50 Antibody (NBP1-81988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM50 Antibody (NBP1-81988) (0)

There are no reviews for TRIM50 Antibody (NBP1-81988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM50 Antibody (NBP1-81988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM50