TRIM50 Antibody

Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TRIM50 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM50
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRIM50 Protein (NBP1-81988PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM50 Antibody

• tripartite motif containing 50
• tripartite motif protein 50
• tripartite motif-containing 50A
• tripartite motif-containing protein 50

Background

The TRIM50 gene codes a E3 ubiquitin-protein ligase TRIM50 protein that exists in two isoforms: isoform alpha is 487 amino acids long at 54 kDA while isoform beta is 486 amino acids long at 54 kDA. TRIM50 is associated with Williams-Beuren syndrome and interacts with genes UBE2D1, UBE2D2, UBE2D3, UBE2D4 and UBE2E1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM50