TRIM50 Antibody


Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TRIM50 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
Specificity of human TRIM50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM50 Protein (NBP1-81988PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRIM50 Antibody

  • tripartite motif containing 50
  • tripartite motif protein 50
  • tripartite motif-containing 50A
  • tripartite motif-containing protein 50


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, PEP-ELISA, IF
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TRIM50 Antibody (NBP1-81988) (0)

There are no publications for TRIM50 Antibody (NBP1-81988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM50 Antibody (NBP1-81988) (0)

There are no reviews for TRIM50 Antibody (NBP1-81988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM50 Antibody (NBP1-81988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TRIM50 Products

Bioinformatics Tool for TRIM50 Antibody (NBP1-81988)

Discover related pathways, diseases and genes to TRIM50 Antibody (NBP1-81988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM50 Antibody (NBP1-81988)

Discover more about diseases related to TRIM50 Antibody (NBP1-81988).

Pathways for TRIM50 Antibody (NBP1-81988)

View related products by pathway.

PTMs for TRIM50 Antibody (NBP1-81988)

Learn more about PTMs related to TRIM50 Antibody (NBP1-81988).

Blogs on TRIM50

There are no specific blogs for TRIM50, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIM50 Antibody and receive a gift card or discount.


Gene Symbol TRIM50