Vinculin Antibody (9I3Y8)

Western Blot: Vinculin Antibody (9I3Y8) [NBP3-16145] - Western blot analysis of lysates from HeLa cells using Vinculin Rabbit mAb at 1:320000-1:1280000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: Vinculin Antibody (9I3Y8) [NBP3-16145] - Confocal imaging of paraffin-embedded Human colon cancer tissue using Vinculin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Analysis of lysates from PC-12 cells using Vinculin Rabbit mAb at 1:200000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Analysis of various lysates using Vinculin Rabbit mAb at 1:50000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 9I3Y8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Vinculin Antibody (9I3Y8) Summary

• Description: Novus Biologicals Rabbit Vinculin Antibody (9I3Y8) (NBP3-16145) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: VCL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:800 - 1:3200
  • Immunohistochemistry 1:800 - 1:3200
  • Immunohistochemistry-Paraffin 1:800 - 1:3200
  • Western Blot 1:50000 - 1:200000
• Theoretical MW: 124 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Vinculin Antibody (9I3Y8)

• CMD1W
• CMH15
• metavinculin
• MVCL
• VCL
• Vinculin

Background

Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Vinculin Antibody (NBP3-16145). (Showing 1 - 1 of 1 FAQ).

1. Do you have any 100 coda or bigger controls?
   • I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

Bioinformatics

• Gene Symbol: VCL