Vinculin Antibody (9I3Y8) Summary
| Description |
Novus Biologicals Rabbit Vinculin Antibody (9I3Y8) (NBP3-16145) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
VCL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Immunocytochemistry/ Immunofluorescence 1:800 - 1:3200
- Immunohistochemistry 1:800 - 1:3200
- Immunohistochemistry-Paraffin 1:800 - 1:3200
- Western Blot 1:50000 - 1:200000
|
| Theoretical MW |
124 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Vinculin Antibody (9I3Y8)
Background
Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for Vinculin Antibody (NBP3-16145) (0)
There are no publications for Vinculin Antibody (NBP3-16145).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Vinculin Antibody (NBP3-16145) (0)
There are no reviews for Vinculin Antibody (NBP3-16145).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Vinculin Antibody (NBP3-16145). (Showing 1 - 1 of 1 FAQ).
-
Do you have any 100 coda or bigger controls?
- I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.
Secondary Antibodies
| |
Isotype Controls
|
Additional Vinculin Products
Research Areas for Vinculin Antibody (NBP3-16145)
Find related products by research area.
|
Blogs on Vinculin