VCAM-1/CD106 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit VCAM-1/CD106 Antibody - BSA Free (NBP2-55858) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
VCAM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VCAM-1/CD106 Antibody - BSA Free
Background
CD106 is a 110 kD glycosylphosphatidylinositol (GPI)-linked transmembrane protein, also known as VCAM-1 and INCAM-110. It is constitutively expressed on bone marrow stromal cells, myeloid progenitors, splenic dendritic cells, activated endothelial cells, as well as some lymphocytes. CD106 expression can be upregulated on endothelial cells by inflammatory cytokines. CD106 is involved in adhesion and acts as a counter-receptor for VLA-4 ( alpha4/ beta1 integrin) and LPAM-1 ( alpha4/ beta7 integrin). The 429 antibody has been reported to partially block VCAM-1-mediated binding.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ICC/IF
Publications for VCAM-1/CD106 Antibody (NBP2-55858) (0)
There are no publications for VCAM-1/CD106 Antibody (NBP2-55858).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VCAM-1/CD106 Antibody (NBP2-55858) (0)
There are no reviews for VCAM-1/CD106 Antibody (NBP2-55858).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VCAM-1/CD106 Antibody (NBP2-55858) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VCAM-1/CD106 Products
Research Areas for VCAM-1/CD106 Antibody (NBP2-55858)
Find related products by research area.
|
Blogs on VCAM-1/CD106