VAV2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VAV2 Antibody [NBP1-86520] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VAV2 Antibody [NBP1-86520] - Staining of human gall bladder shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VAV2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAV2 Antibody - BSA Free (NBP1-86520) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-VAV2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWI
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAV2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: ICC/IF reported in scientific literature (PMID: 26147533). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VAV2 Protein (NBP1-86520PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26147533).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VAV2 Antibody - BSA Free

• guanine nucleotide exchange factor VAV2
• oncogene VAV2
• Protein vav-2
• vav 2 guanine nucleotide exchange factor
• vav 2 oncogene
• VAV-2

Background

The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). Vav and Vav2 are members of the dbl family of guanine nucleotide exchange factors (GEF) for the rho/rac family of GTP binding proteins. Vav is expressed primarily in hematopoietic cells, while vav2 has a wider tissue distribution (2). Vav2 serves as a guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. Unlike Vav1, whose expression is restricted to cells of hematopoietic origin, Vav2 is broadly expressed. Recently, Vav2 has been identified as a substrate for the epidermal growth factor (EGF) receptor. EGF receptor phosphorylates Vav2 on all three possible phosphorylation sites, Tyr-142, Tyr-159, and Tyr-172. results suggest that EGF regulates Vav2 activity basically through phosphatidylinositol 3-kinase activation, whereas tyrosine phosphorylation of Vav2 may rather be necessary for mediating protein-protein interactions (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VAV2 Antibody (NBP1-86520)(1)

Publication using NBP1-86520

• Shuyong Zhu, Chengjiang Zhao, Yingying Wu et al. Identification of a Vav2-dependent mechanism for GDNF/Ret control of mesolimbic DAT trafficking. Nature Neuroscience 2015-07-06 [PMID: 26147533] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: VAV2