U2AF2 Antibody

Images

 
Genetic Strategies: Western Blot: U2AF2 Antibody [NBP2-33397] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry: U2AF2 Antibody [NBP2-33397] - Staining of human colon shows strong nuclear positivity in glandular cells.
Western Blot: U2AF2 Antibody [NBP2-33397] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Simple Western: U2AF2 Antibody [NBP2-33397] - Simple Western lane view shows a specific band for U2AF2 in 0.2 mg/ml of HEK 293T lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: U2AF2 Antibody [NBP2-33397] - Electropherogram image of the corresponding Simple Western lane view. U2AF2 antibody was used at 1:25 dilution on HEK 293T lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

U2AF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS
Specificity
Specificity of human U2AF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2AF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
U2AF2 Protein (NBP2-33397PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for U2AF2 Antibody

  • hU2AF(65)
  • hU2AF65
  • splicing factor U2AF 65 kD subunit
  • splicing factor U2AF 65 kDa subunit
  • U2 (RNU2) small nuclear RNA auxiliary factor 2
  • U2 auxiliary factor 65 kDa subunit
  • U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
  • U2 small nuclear RNA auxiliary factor 2
  • U2AF65U2 snRNP auxiliary factor large subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: ICC/IF
NB100-2859
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33397
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for U2AF2 Antibody (NBP2-33397) (0)

There are no publications for U2AF2 Antibody (NBP2-33397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U2AF2 Antibody (NBP2-33397) (0)

There are no reviews for U2AF2 Antibody (NBP2-33397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for U2AF2 Antibody (NBP2-33397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for U2AF2 Antibody (NBP2-33397)

Discover related pathways, diseases and genes to U2AF2 Antibody (NBP2-33397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for U2AF2 Antibody (NBP2-33397)

Discover more about diseases related to U2AF2 Antibody (NBP2-33397).
 

Pathways for U2AF2 Antibody (NBP2-33397)

View related products by pathway.

PTMs for U2AF2 Antibody (NBP2-33397)

Learn more about PTMs related to U2AF2 Antibody (NBP2-33397).

Blogs on U2AF2

There are no specific blogs for U2AF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our U2AF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF2
Uniprot