SNRP70 Antibody

Images

 
Western Blot: SNRP70 Antibody [NBP1-57487] - Antibody Titration: 1 ug/ml HEK293.
Immunohistochemistry-Paraffin: SNRP70 Antibody [NBP1-57487] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: SNRP70 Antibody [NBP1-57487] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: SNRP70 Antibody [NBP1-57487] - Antibody Titration: 1 ug/ml Human Raji.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRP70 Antibody Summary

Immunogen
Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRNP70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SNRP70 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-57487 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SNRP70 Antibody

  • RNPU1ZU170K
  • RPU1U1AP
  • small nuclear ribonucleoprotein 70kDa (U1)
  • Snp1
  • snRNP70
  • SNRP70U1 small nuclear ribonucleoprotein 70 kDa
  • U1 snRNP 70 kDa
  • U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen)
  • U1AP1
  • U1RNP

Background

SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP2-38755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SNRP70 Antibody (NBP1-57487)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SNRP70 Antibody (NBP1-57487) (0)

There are no reviews for SNRP70 Antibody (NBP1-57487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRP70 Antibody (NBP1-57487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRP70 Products

Bioinformatics Tool for SNRP70 Antibody (NBP1-57487)

Discover related pathways, diseases and genes to SNRP70 Antibody (NBP1-57487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRP70 Antibody (NBP1-57487)

Discover more about diseases related to SNRP70 Antibody (NBP1-57487).
 

Pathways for SNRP70 Antibody (NBP1-57487)

View related products by pathway.

PTMs for SNRP70 Antibody (NBP1-57487)

Learn more about PTMs related to SNRP70 Antibody (NBP1-57487).

Blogs on SNRP70

There are no specific blogs for SNRP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRNP70
Entrez
Uniprot