PTBP2 Antibody (10S9P6)

Western Blot: PTBP2 Antibody (10S9P6) [NBP3-16756] - Western blot analysis of extracts of various cell lines, using PTBP2 Rabbit mAb (NBP3-16756) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of U-2 OS cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of A549 cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [NBP3-16756] - Confocal imaging of paraffin-embedded Mouse brain using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [NBP3-16756] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [PTBP2] - Confocal imaging of paraffin-embedded Mouse brain using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [PTBP2] - Confocal imaging of A549 cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PTBP2 Antibody (10S9P6) [PTBP2] - Confocal imaging of U-2 OS cells using PTBP2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PTBP2 Antibody (10S9P6) [PTBP2] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PTBP2 Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 10S9P6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PTBP2 Antibody (10S9P6) Summary

• Description: Novus Biologicals Rabbit PTBP2 Antibody (10S9P6) (NBP3-16756) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9). MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PTBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTBP2 Antibody (10S9P6)

• brPTB
• FLJ34897
• neural polypyrimidine tract binding protein
• Neural polypyrimidine tract-binding protein
• Neurally-enriched homolog of PTB
• nPTB
• nPTB6
• nPTB7
• nPTB8
• polypyrimidine tract binding protein 2
• polypyrimidine tract-binding protein 2
• PTB-like protein
• PTBPTBLPnPTB5
• splicing regulator

Background

PTBP2 is encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTBP2