TM2D1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TM2D1 Antibody [NBP2-13436] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TM2D1 Antibody [NBP2-13436] - Staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM2D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM2D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TM2D1 Protein (NBP2-13436PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TM2D1 Antibody

  • BBPBeta-amyloid-binding protein
  • hBBP
  • TM2 domain containing 1
  • TM2 domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for TM2D1 Antibody (NBP2-13436) (0)

There are no publications for TM2D1 Antibody (NBP2-13436).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM2D1 Antibody (NBP2-13436) (0)

There are no reviews for TM2D1 Antibody (NBP2-13436). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TM2D1 Antibody (NBP2-13436) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM2D1 Products

Bioinformatics Tool for TM2D1 Antibody (NBP2-13436)

Discover related pathways, diseases and genes to TM2D1 Antibody (NBP2-13436). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TM2D1

There are no specific blogs for TM2D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM2D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM2D1