Splicing Factor 1 Antibody (2E12.)

Images

 
Western Blot: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01), clone 2E12.Lane 1: SF1 transfected lysate (Predicted MW: 59.7 ...read more
Immunocytochemistry/ Immunofluorescence: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of monoclonal antibody to SF1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - SF1 monoclonal antibody (M01), clone 2E12. Analysis of SF1 expression in HeLa.
Western Blot: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - SF1 monoclonal antibody (M01), clone 2E12. Analysis of SF1 expression in NIH/3T3.
Western Blot: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01A), clone 2E12.Lane 1: SF1 transfected lysate (Predicted MW: 59.7 ...read more
Immunoprecipitation: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of SF1 transfected lysate using anti-SF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SF1 monoclonal antibody.
ELISA: Splicing Factor 1 Antibody (2E12.) [H00007536-M01] - Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Detection limit for recombinant GST tagged SF1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
2E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Splicing Factor 1 Antibody (2E12.) Summary

Immunogen
SF1 (NP_004621, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Specificity
SF1 - splicing factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Splicing Factor 1 Antibody (2E12.)

  • Mammalian branch point-binding protein
  • mBBP
  • splicing factor 1
  • Transcription factor ZFM1
  • ZFM1BBP
  • Zinc finger gene in MEN1 locus
  • Zinc finger protein 162D11S636
  • ZNF162MBBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
PP-H7431-00
Species: Hu
Applications: WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-86993
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF475
Species: Mu
Applications: WB, IHC
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for Splicing Factor 1 Antibody (H00007536-M01) (0)

There are no publications for Splicing Factor 1 Antibody (H00007536-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Splicing Factor 1 Antibody (H00007536-M01) (0)

There are no reviews for Splicing Factor 1 Antibody (H00007536-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Splicing Factor 1 Antibody (H00007536-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Splicing Factor 1 Antibody (H00007536-M01)

Discover related pathways, diseases and genes to Splicing Factor 1 Antibody (H00007536-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Splicing Factor 1 Antibody (H00007536-M01)

Discover more about diseases related to Splicing Factor 1 Antibody (H00007536-M01).
 

Pathways for Splicing Factor 1 Antibody (H00007536-M01)

View related products by pathway.

PTMs for Splicing Factor 1 Antibody (H00007536-M01)

Learn more about PTMs related to Splicing Factor 1 Antibody (H00007536-M01).

Blogs on Splicing Factor 1

There are no specific blogs for Splicing Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Splicing Factor 1 Antibody (2E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SF1
Entrez
OMIM
Uniprot