PTBP1 Antibody (3H8) - Azide and BSA Free

Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of PTBP1 expression in transfected 293T cell line by PTBP1 monoclonal antibody (M01), clone 3H8.Lane 1: PTBP1 transfected lysate(59.6 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of monoclonal antibody to PTBP1 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of monoclonal antibody to PTBP1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - 2 minute exposure for Mouse embryonic stem cell - V6.5 with a dilution of 1:500 - Courtesy of Paul Fields at MIT

Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - 5 minute exposure for Mouse embryonic stem cell - V6.5 with a dilution of 1:500 - Courtesy of Paul Fields at MIT

Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - PTBP1 monoclonal antibody (M01), clone 3H8 Analysis of PTBP1 expression in A-431.

Immunoprecipitation: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of PTBP1 transfected lysate using anti-PTBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTBP1 MaxPab rabbit polyclonal antibody.

ELISA: PTBP1 Antibody (3H8) [H00005725-M01] - Detection limit for recombinant GST tagged PTBP1 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, IP, Single-Cell Western
• Clone: 3H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTBP1 Antibody (3H8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PTBP1 (NP_002810, 45 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
• Specificity: PTBP1 - polypyrimidine tract binding protein 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PTBP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Single Cell Western 1:10
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. SCW is validated using U373 cells.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTBP1 Antibody (3H8) - Azide and BSA Free

• Heterogeneous nuclear ribonucleoprotein I
• heterogeneous nuclear ribonucleoprotein polypeptide I
• hnRNP I
• HNRNPI
• HNRNP-I
• HNRPI
• MGC10830
• MGC8461
• polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI)
• polypyrimidine tract binding protein 1
• polypyrimidine tract-binding protein 1
• pPTB
• PTB-1
• PTB2
• PTB3
• PTB4
• PTB57 kDa RNA-binding protein PPTB-1
• PTB-T
• RNA-binding protein

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTBP1 Antibody (H00005725-M01)(4)

Publications using H00005725-M01

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01
• Yamauchi KA, Herr AE. Subcellular western blotting of single cells Microsyst Nanoeng 2018-01-16 [PMID: 29333327]
• Rajendran D, Zhang Y, Berry DM, McGlade CJ. Regulation of Numb isoform expression by activated ERK signaling. Oncogene. 2016-04-04 [PMID: 27041567] (WB, Human)
• Takahashi H, Nishimura J, Kagawa Y et al. Significance of Polypyrimidine Tract-Binding Protein 1 Expression in Colorectal Cancer. Mol Cancer Ther 2015-07-01 [PMID: 25904505]

Bioinformatics

• Gene Symbol: PTBP1
• Entrez:
  • 5725(Human)
• OMIM:
  • 600693(Human)
• Uniprot:
  • NP_002810(Human)