PTBP1 Antibody (3H8)

Images

 
Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - PTBP1 monoclonal antibody (M01), clone 3H8 Analysis of PTBP1 expression in A-431.
Immunocytochemistry/ Immunofluorescence: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of monoclonal antibody to PTBP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of monoclonal antibody to PTBP1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - 2 minute exposure for Mouse embryonic stem cell - V6.5 with a dilution of 1:500 - Courtesy of Paul Fields at MIT
Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - 5 minute exposure for Mouse embryonic stem cell - V6.5 with a dilution of 1:500 - Courtesy of Paul Fields at MIT
Western Blot: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of PTBP1 expression in transfected 293T cell line by PTBP1 monoclonal antibody (M01), clone 3H8.Lane 1: PTBP1 transfected lysate(59.6 KDa).Lane 2: ...read more
Immunoprecipitation: PTBP1 Antibody (3H8) [H00005725-M01] - Analysis of PTBP1 transfected lysate using anti-PTBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTBP1 MaxPab rabbit polyclonal ...read more
ELISA: PTBP1 Antibody (3H8) [H00005725-M01] - Detection limit for recombinant GST tagged PTBP1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
3H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTBP1 Antibody (3H8) Summary

Immunogen
PTBP1 (NP_002810, 45 a.a. - 144 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
Specificity
PTBP1 - polypyrimidine tract binding protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00005725-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTBP1 Antibody (3H8)

  • Heterogeneous nuclear ribonucleoprotein I
  • heterogeneous nuclear ribonucleoprotein polypeptide I
  • hnRNP I
  • HNRNPI
  • HNRNP-I
  • HNRPI
  • MGC10830
  • MGC8461
  • polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI)
  • polypyrimidine tract binding protein 1
  • polypyrimidine tract-binding protein 1
  • pPTB
  • PTB-1
  • PTB2
  • PTB3
  • PTB4
  • PTB57 kDa RNA-binding protein PPTB-1
  • PTB-T
  • RNA-binding protein

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6106
Species: Hu, Mu, Rt, Am, Bv, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for PTBP1 Antibody (H00005725-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PTBP1 Antibody (H00005725-M01) (0)

There are no reviews for PTBP1 Antibody (H00005725-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTBP1 Antibody (H00005725-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTBP1 Products

Bioinformatics Tool for PTBP1 Antibody (H00005725-M01)

Discover related pathways, diseases and genes to PTBP1 Antibody (H00005725-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTBP1 Antibody (H00005725-M01)

Discover more about diseases related to PTBP1 Antibody (H00005725-M01).
 

Pathways for PTBP1 Antibody (H00005725-M01)

View related products by pathway.

PTMs for PTBP1 Antibody (H00005725-M01)

Learn more about PTMs related to PTBP1 Antibody (H00005725-M01).

Blogs on PTBP1

There are no specific blogs for PTBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTBP1 Antibody (3H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTBP1
Entrez
OMIM
Uniprot