SC35 Antibody

Images

 
Western Blot: SC35 Antibody [NBP2-47290] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: SC35 Antibody [NBP2-47290] - Staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SC35 Antibody [NBP2-47290] - Staining of human tonsil shows moderate to strong positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SC35 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
Specificity
Specificity of human SC35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SC35 Protein (NBP2-47290PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP2-47290 in the following applications:

Publications
Read Publication using NBP2-47290.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25800673)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SC35 Antibody

  • PR264
  • SC35
  • SC-35
  • serine/arginine-rich splicing factor 2
  • SFRS2
  • SFRS2A
  • splicing component, 35 kDa
  • splicing factor SC35
  • splicing factor, arginine/serine-rich 2
  • SR splicing factor 2
  • SRp30b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF6387
Species: Hu
Applications: WB
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr, KD
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04142
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57487
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32515
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, KD
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NB110-93598
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for SC35 Antibody (NBP2-47290)(1)

Review for SC35 Antibody (NBP2-47290) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-47290:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen SC35 NBP2-47290
Enlarge
reviewed by:
Anonymous
IHC-Fr Mouse 12/20/2016
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedLiver
SpeciesMouse
LotA106160

Comments

CommentsThis customer tested the product in an untested application (IHC-Fr) and earned the Innovator's Reward for this product.

Antibody Storage Conditions: -20℃

Staining Expectations: positive signals should be within nucleus

Fixative Composition: PFA
Fixation Time & Temperature: 15 min RT
Tissue Processing: as normal

Blocking Solution: 5% goat serum in PBS
Time & Temperature: 15min RT

Primary Antibody:
Dilution: 1:50
Diluent Buffer: 5% goat serum in PBS
Time & Temperature: 15min RT

Washing Conditions:
Wash Buffer Composition: PBS
Times/Washing: 5min x 3 times
Repetitions: 3

Secondary Antibody
Manufacturer and Catalog #: life technologies Ref:A11034
Secondary description: goat anti Rabit
Dilution: 1:2000
Diluent Buffer: 5% goat serum in PBS
Incubation Time & Temperature: 1 hour RT

Post-Secondary Washing: PBS

Detection Method:
Detection: confocal
Procedure: as olypus
DAB-Incubation Time (if applicable): Click here to enter text.

Controls:
Positive Control: No
Negative Control: no




Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SC35 Antibody (NBP2-47290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SC35 Products

Bioinformatics Tool for SC35 Antibody (NBP2-47290)

Discover related pathways, diseases and genes to SC35 Antibody (NBP2-47290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SC35 Antibody (NBP2-47290)

Discover more about diseases related to SC35 Antibody (NBP2-47290).
 

Pathways for SC35 Antibody (NBP2-47290)

View related products by pathway.

PTMs for SC35 Antibody (NBP2-47290)

Learn more about PTMs related to SC35 Antibody (NBP2-47290).

Blogs on SC35

There are no specific blogs for SC35, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Anonymous
12/20/2016
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol SRSF2