Secretin R Antibody

Images

 
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human pancreas shows strong membranous positivity in interlobular ducts.
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Secretin R Antibody [NBP1-86125] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Secretin R Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL
Specificity
Specificity of human Secretin R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCTR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Secretin R Protein (NBP1-86125PEP)
Publications
Read Publication using NBP1-86125.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24522493)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secretin R Antibody

  • pancreatic secretin receptor
  • SCTR
  • SCT-R
  • Secretin R
  • secretin receptor
  • SecretinR
  • SR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-19807
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ma, Fi, Ma-Mn, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-76961
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-92826
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Secretin R Antibody (NBP1-86125)(1)

Reviews for Secretin R Antibody (NBP1-86125) (0)

There are no reviews for Secretin R Antibody (NBP1-86125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Secretin R Antibody (NBP1-86125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Secretin R Products

Bioinformatics Tool for Secretin R Antibody (NBP1-86125)

Discover related pathways, diseases and genes to Secretin R Antibody (NBP1-86125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretin R Antibody (NBP1-86125)

Discover more about diseases related to Secretin R Antibody (NBP1-86125).
 

Pathways for Secretin R Antibody (NBP1-86125)

View related products by pathway.

PTMs for Secretin R Antibody (NBP1-86125)

Learn more about PTMs related to Secretin R Antibody (NBP1-86125).
 

Research Areas for Secretin R Antibody (NBP1-86125)

Find related products by research area.

Blogs on Secretin R

There are no specific blogs for Secretin R, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretin R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCTR