HNRPDL Antibody

Images

 
Western Blot: HNRPDL Antibody [NBP2-38806] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: HNRPDL Antibody [NBP2-38806] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry: HNRPDL Antibody [NBP2-38806] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HNRPDL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM
Specificity
Specificity of human HNRPDL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRPDL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
TOR3A Lysate (NBP2-65041)
HNRPDL Lysate (NBP2-65042)
Control Peptide
HNRPDL Protein (NBP2-38806PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HNRPDL Antibody

  • A+U-rich element RNA binding factor
  • AU-rich element RNA-binding factor
  • heterogeneous nuclear ribonucleoprotein D-like
  • hnRNP DL
  • hnRNP D-like
  • HNRNP
  • JKTBP2
  • JKTBPJKT41-binding protein
  • laAUF1
  • Protein laAUF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB600-961
Species: Hu
Applications: WB, IP
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
MAB1936
Species: Hu
Applications: WB, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for HNRPDL Antibody (NBP2-38806) (0)

There are no publications for HNRPDL Antibody (NBP2-38806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNRPDL Antibody (NBP2-38806) (0)

There are no reviews for HNRPDL Antibody (NBP2-38806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNRPDL Antibody (NBP2-38806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HNRPDL Antibody (NBP2-38806)

Discover related pathways, diseases and genes to HNRPDL Antibody (NBP2-38806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNRPDL Antibody (NBP2-38806)

Discover more about diseases related to HNRPDL Antibody (NBP2-38806).
 

Pathways for HNRPDL Antibody (NBP2-38806)

View related products by pathway.

Blogs on HNRPDL

There are no specific blogs for HNRPDL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNRPDL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRPDL
Uniprot